KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1705Help
Entry
PMCN06_1705       CDS       T01776                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PMCN06_1705 (glpK)
Enzymes [BR:pmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PMCN06_1705 (glpK)
Exosome [BR:pmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMCN06_1705 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805165..1806673
Genome map
AA seq 502 aa AA seqDB search
MTDKKYIIALDQGTTSSRAVLLDHDANIVEIAQREFTQIYPQAGWVEHNPMEIWATQSST
LNEVVAKAGITADQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTTEITDKLKADG
HEDYIRQTTGLVVDPYFSGTKIKWILDNVEGAREQAERGELLFGTVDTWLVWKLTQGRAH
VTDYTNASRTMLFNIHTLQWDDNMLAILGIPRAMLPEVRNSSEIYGQTNIGGKGGVRIPV
AGMAGDQQAALYGHLCVNAGQAKNTYGTGCFMLMHTGDKAVQSQNGLLTTIACNAKGEPA
YALEGSIFMGGASIQWLRDELKIVHDSYDSEYFATRVPDCNGVYVVPAFTGLGAPYWDPY
ARGAIFGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGQTLQALRVDGGATENNFLM
QFQADILATKVERPKVKEVTALGAAYLAGLATGFWKDLSELRDKASIEKTFVPDGDEAKR
TRRYKGWKKAVKRALEWEKEEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaaaaatatatcattgccctagatcaaggtacaacaagttcaagagcggtt
cttcttgatcacgatgccaatattgttgaaattgcccaacgtgaatttacgcaaatttat
ccacaggctggctgggttgaacataatcccatggagatttgggcaacacaaagttccacc
ttaaatgaagtggtcgcgaaagccggtatcactgctgatcaaatcgcggcaattgggatc
actaatcagcgtgaaaccacgattgtatgggaaaaagaaaccggtaagccaatttacaat
gcgattgtgtggcaatgccggcgtacgactgagataaccgataaactgaaagcagatggt
cacgaagactatatacgtcaaacgacaggcttagtggtagatccttacttctctggaacc
aaaattaaatggattttggataacgtggaaggggcacgggagcaagcagaacgtggcgaa
ttactctttggtacggtggatacttggctagtatggaaattaactcaagggcgtgcacat
gtcaccgattacactaacgcctcgcggacgatgttatttaatattcatactctgcaatgg
gacgataacatgctggcgattttaggtatcccacgtgctatgttgcctgaggtgcgtaat
tcttctgaaatatatggtcaaaccaatatcggtggcaaaggtggcgtacgtattcctgta
gccggtatggcaggagatcaacaagcggccttatatggtcatctttgtgttaatgcggga
caagcgaaaaacacttatggtaccggttgtttcatgttaatgcatacgggcgacaaagcc
gtacaatcacaaaatggcttattaaccaccattgcctgtaatgccaaaggtgagcctgca
tatgctctcgaaggctccatcttcatgggcggggcatccattcaatggctacgcgatgag
ctcaaaattgtgcatgatagctatgactcagaatattttgccacccgagtacctgattgt
aatggtgtctatgtggtacctgcctttaccggattaggtgccccttattgggatccctat
gcacgcggtgccatttttgggctctcacgtggtgcaaatcgcaaccacattgtgcgcgct
actttagaatctattgcataccaaactcgcgatgtgctagaggcgatgcaatctgattca
gggcaaacactgcaagcgctccgtgtggacggtggagcaacggaaaataatttcttaatg
cagttccaagcggatattctcgccaccaaagtagaaagaccaaaagtgaaagaagtcacg
gcattaggcgccgcctatcttgcgggtcttgcgacgggtttctggaaagatctcagtgaa
ttgcgtgataaagccagcatcgaaaaaacttttgttcccgatggagatgaagccaaacgc
actcgccgttataaaggctggaaaaaagcagtcaaacgtgcgctcgaatgggaaaaagag
gaagagtag

DBGET integrated database retrieval system