KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1717Help
Entry
PMCN06_1717       CDS       T01776                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pmv01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmv00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmv00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pmv00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pmv00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pmv00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pmv00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:pmv00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1820916..1823543
Genome map
AA seq 875 aa AA seqDB search
MMSHTAEIEISPAQAEVNVLVEKGLLALEAFRQLNQQQVDYIVAKASVAALDQHGVLAMH
AYEETGRGVFEDKATKNLFACEYVVNNMRNLKTVGVISEDDVTGITEIADPVGVVCGITP
TTNPTSTTIFKALISLKTRNPIVFAFHPSAQQCSAHAARVVYEAAVAAGAPEHCIQWIET
PSMEGTAALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKSANIKQATH
DIVMSKAFDNGMICASEQAAIVDQEVYDEFVAEMQSYGAYFVNKKEKALLETFLFGVKVN
STNCANAKLNAAVVGKPATWIAEQAGFKVPEKTNILVAACQEVGENEPLTREKLSPVLAI
LKSTSTEHGFALSEAMVNFHGLGHSAAIHTKEASIAKAFGERVKAIRVIWNSPATFGGIG
DVYNAFLPSLTLGCGSYGKNSVGNNVSAANLLNIKRVGRRRNNMQWFKVPSKIYFERDSI
QYLQSMKGMERVVIVTDRTMVDLGFVEKIAKQITARGNHVTYQLFADVEPDPSIETVRRG
AALIRNYQPDTIIALGGGSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGR
KARFIGIPTTSGTGSEVTPFAVITEGDKKYPIADYSLTPTVAIVDPAFVMSVPAHVAADT
GLDVLTHATEAYVSVLANDFTDGLALQAIKLVFEHLERSVKDKDPEAREKMHNASTMAGM
AFANAFLGMNHSLAHKIGGRFHTPHGRTNAVLMPHVIRYNGTRPQKTATWPKYNYYKADV
KYQDIARMLGLPCATPEEGVKSFAQACYDLAIRVGIKMSFKEQGIDEKEWMDARRQVALL
AFEDQCSPANPRLPVVSDMEVILTNAYYGYDANQY
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcatactgctgaaattgaaatcagcccagcacaagcagaagtgaatgtactg
gttgaaaaaggattgctggcattagaagcattccgtcagcttaatcaacagcaagtggat
tacattgtggcaaaagcctcagtagctgctttagatcaacatggggtgcttgctatgcat
gcttatgaagaaacggggcgcggggtatttgaagataaagccaccaaaaatctgtttgcc
tgtgaatatgtagtcaacaatatgcggaatttgaaaaccgtgggggtgatcagtgaggat
gatgtcacagggatcaccgaaattgcagaccctgttggcgtggtttgtggaattacccca
acgaccaacccgacgtccaccaccattttcaaagcccttatctcgctaaaaacccgtaac
cccatcgtctttgcatttcatccttccgcacaacaatgttctgctcatgcggcacgcgta
gtctatgaggcagccgttgcagcgggggcgcctgaacattgtattcaatggattgaaacc
ccgtcgatggaaggtaccgcagcgctgatgaaacaccctggcattgctaccattcttgct
acgggcggcaatgcgatggttgaggcggcgtattcttgtggtaaaccagctcttggcgta
ggagcgggtaacgtacctgcttatgtggaaaaaagcgcaaatatcaaacaagctacacat
gatattgtgatgtcaaaagcctttgataacggcatgatttgtgcctctgaacaagccgct
attgtcgatcaagaggtgtacgatgaatttgtggcagaaatgcagtcttatggtgcttac
tttgtaaataaaaaagaaaaagccttgttagaaacatttcttttcggcgtcaaagtcaac
agtacaaattgtgctaacgcaaaattaaatgccgcggttgtgggaaaacctgccacatgg
atcgccgaacaagcgggcttcaaagtgccagaaaaaaccaatattttggtggcagcctgt
caagaagtgggcgaaaacgaaccccttacccgtgaaaaactttccccagtcctcgcgata
ttaaaatccacgtcaacagaacatggctttgcgttatctgaagccatggtgaatttccat
ggtttaggacattccgccgccattcatactaaagaggcaagcattgccaaagcctttggc
gaacgcgtgaaagccattcgtgtgatttggaactcgcctgcgacctttgggggcattggc
gatgtgtataatgccttcctcccgtcactcacactcggttgtggttcctacgggaaaaac
tccgtcggtaacaatgtcagtgcagccaatttattaaatattaaacgtgtgggaagacgg
agaaataacatgcaatggttcaaagtgccttcaaaaatctattttgaacgggattcaatt
caatatttacaatcgatgaaaggcatggaacgcgtggtgattgtcactgacagaaccatg
gtggatctaggctttgtggaaaaaattgctaaacaaattaccgcgcgtggtaaccatgtg
acctaccaattgtttgctgatgtagaacctgatccatctatcgaaacggtacgccgtggc
gcagcattaattcgcaactaccaacccgatacgattattgcgttaggcggtggatcggca
atggatgcggcaaaagtcatgtggttgttctatgaacaacctgaagtggatttccgtgat
ttagtccaaaaattcatggatattcgcaaacgggcgttcaaattcccacaattagggcgc
aaagcgcgctttatcggcattccaacgacttcaggcacaggttcagaagtcacgccattt
gcggtcatcaccgaaggcgataaaaaataccctatcgctgactactcgctcaccccaaca
gtcgccattgtggatccggcttttgtgatgagtgtgccggcacacgtcgctgcggatacc
ggactagacgtgttaacccatgccacggaagcttatgtgtcagtgctcgccaacgacttt
accgacggtttagccctacaagcgatcaagctcgtgtttgaacatttagaacgctccgtg
aaagacaaagatcccgaagcgcgtgaaaaaatgcacaatgcgtccaccatggcagggatg
gcatttgctaacgccttcttgggcatgaaccactcccttgcacacaaaattggtgggcgt
ttccacactccacatggtcgtaccaatgcggtcttaatgccacatgtgattcgttataac
ggcacacgtccacaaaaaacggcaacgtggccaaaatacaattactacaaagcggatgtg
aaataccaagatatcgcgcgtatgctcggtttaccttgtgccacaccagaagaaggggtg
aaatcctttgcacaagcgtgctatgacttagccattcgcgtgggtatcaagatgtccttc
aaagagcaaggtattgatgaaaaagaatggatggacgctcgtcgccaagtcgcgttactc
gcctttgaagaccaatgttcgccagccaacccacgtttacctgtagtaagcgatatggag
gtgatcttaaccaatgcctactatggttatgatgccaatcaatactga

DBGET integrated database retrieval system