KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1810Help
Entry
PMCN06_1810       CDS       T01776                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PMCN06_1810 (cysQ)
Enzymes [BR:pmv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PMCN06_1810 (cysQ)
Transfer RNA biogenesis [BR:pmv03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PMCN06_1810 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1921988..1922815
Genome map
AA seq 275 aa AA seqDB search
MLALSPSLLEKTLEIADQAGDFLTRFYTDSGQNALAIQTKQDNTPVTAVDLFLSQFLIEK
LTALTPEVPILSEESCKIPLQDRAHWAEYWLIDPLDGTQQFINRTDQFSILITLVQHNQP
VLSITHAPILQTTYYAMQGFGAYRRQGNQQEKLNNQARPEQRKIKIAVGVGGVERKIQPL
LNPAYQYEFLVYGSSGLKGGLVADGTCDCYIRVGKTGEWDTGAAEILLREMGGAVFDFAF
QPLSYNQRESFINPNFVMVANTEFDWQKIFQFHSH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttagcactttcaccatcattacttgaaaaaacacttgaaatcgcggatcaagcaggg
gattttttaacgcgattttataccgactcagggcaaaatgcgttagcaattcaaaccaaa
caagataacacgccagtgactgccgtggatttatttttgagtcaatttttaattgaaaaa
ttgaccgcactgacacctgaggtcccgattctttccgaagagagttgtaaaatcccctta
caagatcgtgcacattgggcagaatattggttaattgacccactcgatggaacccaacaa
tttattaatcgcaccgatcaattttccattttgattacacttgtccaacacaatcaaccc
gtcttaagcattacccatgcccctattttacaaacgacttattatgctatgcagggcttt
ggtgcttacagaaggcagggcaatcaacaagaaaagctaaacaaccaagcgcgacctgag
cagcgaaaaatcaaaattgctgtgggagtcgggggcgttgaacggaaaattcagcccttg
ttaaatccagcttatcaatatgaatttttggtttatggttcaagtggtttaaaaggcggc
ttagtggccgatggcacttgtgattgctatattcgagtaggaaaaacgggtgaatgggat
acgggggcggctgaaatcctcttacgtgaaatgggaggtgctgtgtttgactttgctttt
caaccgcttagctataatcagagagaaagttttattaatcccaattttgtgatggtggcg
aatacagaatttgattggcagaaaatttttcaatttcattcgcactag

DBGET integrated database retrieval system