KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_1954Help
Entry
PMCN06_1954       CDS       T01776                                 

Gene name
ugp2
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PMCN06_1954 (ugp2)
   00052 Galactose metabolism
    PMCN06_1954 (ugp2)
   00500 Starch and sucrose metabolism
    PMCN06_1954 (ugp2)
   00520 Amino sugar and nucleotide sugar metabolism
    PMCN06_1954 (ugp2)
Enzymes [BR:pmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PMCN06_1954 (ugp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072454..2073341
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGMKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLDEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVILPDVLLADFSADQKRENLAAMVKRFEETQTSQIMVAPVAEKEVSSYGIVDCGGA
DLKGGESTKIHSIVEKPSLDKAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKEVVEAFHMTGKSFDCGDKIGYMQAFVEYGLQHDKLGQQFKAYLQQLVKSF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattatccccgtcgcaggtttagggacacgaatgttacccgcgacaaaggcg
attcctaaagaaatgttaacgctggtggataagccgttaattcaatatgttgtgaatgaa
tgcgtggctgctggtatgaaggaaattgtcttggtgacacattcttcaaaaaatgccatt
gaaaaccattttgatacctcatttgaattggagacaatgctagaaaaacgtgttaaacgt
caacttttagatgaggttcgctcgatttgtccaaaaaatgtgacaattatgcatgtccgt
caaggtaatgcgaaaggcttaggacatgccgttttatgtggcagaccattagttggaaat
gagccatttgctgtgattctaccggatgtactattggctgatttttcagcggatcaaaaa
cgtgagaatctggctgcaatggttaaacgttttgaggaaacacaaacgagccagattatg
gttgcgcctgttgctgaaaaagaggtcagtagctacggtatcgtagattgtggcggagct
gatttaaaaggtggcgaaagtacaaaaattcatagtattgttgagaaaccgagtttagac
aaagccccttctaatttagcggtggttggacgttacgttttctcagcggcaatttgggac
ttgttggaaaaaactccgattggtgtcggcgatgaaattcaattaaccgatgcgattgat
atgttaattgaaaaagaagtcgttgaagcgttccatatgacaggaaaatccttcgattgt
ggtgataaaattggttatatgcaagcgtttgtggagtatggattacagcatgataaatta
ggtcagcaattcaaagcgtatttgcaacagctcgtcaaaagtttttaa

DBGET integrated database retrieval system