KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_2166Help
Entry
PMCN06_2166       CDS       T01776                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv00860  Porphyrin and chlorophyll metabolism
pmv01100  Metabolic pathways
pmv01110  Biosynthesis of secondary metabolites
pmv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMCN06_2166 (hemB)
Enzymes [BR:pmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PMCN06_2166 (hemB)
Exosome [BR:pmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMCN06_2166 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFF25387
Position
complement(2271425..2272450)
Genome map
AA seq 341 aa AA seqDB search
MTQQIFASFPQRRLRRMRKQAFSRRLMAENKLSVEDLIYPVFIIEGEKQREPVPSMPGVE
RLTIDELLIEAELLVKYGVPVIALFPVIAQEKKSLMAEEAYHPDGLVQRAVKALKDKFPT
ELGILTDIALDPYTTHGQDGIIDQHGYVLNDVTSDILVKQALSHAKAGADIVAPSDMMDG
RIGKIRHALEEKGFINTLIMAYSAKYASHYYGPFRDAVGSATNLKGGDKKTYQLDPANSD
EGLQEVALDLQEGADMVMVKPGMPYLDLVYRVKTHFGVPTFAYQVSGEYAMHQAAIQNGW
LKEKECIMESLLCFKRAGADGILTYYAKQVAEWLYWEKQHQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaaatttttgccagtttccctcaacgtcgcctacgccgtatgcggaaacaa
gctttcagtcgccgtttaatggcagaaaataaactcagcgtagaggatttaatttatccc
gtttttattattgaaggcgaaaagcaaagggaacccgtaccttccatgcctggtgtagaa
cgcttaactattgatgagctattaattgaagccgaacttttagtcaaatatggagtgccg
gtgattgcgcttttcccggtgattgcacaagagaaaaaatccttaatggcagaagaagct
tatcatcctgatggcttagtacagcgcgcggtaaaagcattaaaggacaaattcccaact
gaacttggcatacttactgatattgccctcgatccctatactacacacggacaagacggg
ataattgatcaacatggctatgtgttaaatgatgtcactagcgatattttggtcaaacaa
gcactttcccatgcgaaagcgggcgcagatattgtagcaccaagcgatatgatggacggt
agaattggcaaaattcgccatgccctcgaggaaaaggggtttatcaatacactcattatg
gcgtattctgccaaatatgcttctcattattatggacctttccgcgatgccgtcggttct
gccaccaatttaaaagggggcgataaaaaaacttatcaattagatccggccaatagtgat
gaaggactacaagaagtggcattagatttacaagaaggggcagatatggtgatggtcaaa
cccggcatgccgtatttagatttggtttatcgcgtgaaaacccattttggcgtgccaact
ttcgcttaccaagtatcgggtgagtatgccatgcatcaagctgcgatccaaaacggctgg
ctcaaagaaaaagaatgtattatggaatctttattgtgcttcaaacgtgctggcgccgat
gggattttgacgtattacgccaaacaagtggcagaatggctatattgggaaaaacaacat
caataa

DBGET integrated database retrieval system