KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_2219Help
Entry
PMCN06_2219       CDS       T01776                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv00010  Glycolysis / Gluconeogenesis
pmv00051  Fructose and mannose metabolism
pmv00562  Inositol phosphate metabolism
pmv01100  Metabolic pathways
pmv01110  Biosynthesis of secondary metabolites
pmv01120  Microbial metabolism in diverse environments
pmv01130  Biosynthesis of antibiotics
pmv01200  Carbon metabolism
pmv01230  Biosynthesis of amino acids
Module
pmv_M00002  Glycolysis, core module involving three-carbon compounds
pmv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMCN06_2219 (tpiA)
   00051 Fructose and mannose metabolism
    PMCN06_2219 (tpiA)
   00562 Inositol phosphate metabolism
    PMCN06_2219 (tpiA)
Enzymes [BR:pmv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PMCN06_2219 (tpiA)
Exosome [BR:pmv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PMCN06_2219 (tpiA)
  Exosomal proteins of bladder cancer cells
   PMCN06_2219 (tpiA)
  Exosomal proteins of melanoma cells
   PMCN06_2219 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: AFF25440
Position
2321935..2322984
Genome map
AA seq 349 aa AA seqDB search
MEKKIYFGTNLKMYKGNCETVDYLTQLLALREKLQSDYDIELFVIPSYIALKDAVHAAAS
ETTHKILIGAQNMNAKDKGQFTGEISPLMLKELGVQLVMIGHSERRHVLKETDQEENEKV
LSALKHGFKTLLCVGETLEQKNYQISDEVLRTQLKIGLHGVSVKQLPHLFIAYEPVWAIG
EGGIPATAQYADEKQKIIKQCLFEMFGEESKKIPVLYGGSVNLENANELIMQPHIDGLFV
GRSAWDAQCFYTLIDGALKALAGTTHQFSPIATQLIKHLGGKENISALTHCASRIRVMTR
NENHINKVAIEKINGVSGLFSIANQYQIIVGPKWVEKIYSEMKALLETE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaatttactttggtacaaatttaaaaatgtataaaggtaattgtgaaaca
gtcgattaccttactcagttacttgccctcagagaaaaacttcaatctgattatgatatt
gaattatttgtcattccttcttatatcgccttaaaagatgctgtacatgcagcggcatca
gagacaacgcataaaattcttattggtgcacagaacatgaatgctaaggataaggggcag
tttactggcgaaatttcaccactcatgttgaaagagctaggggttcagttggtcatgatt
gggcattctgaacgtcgccatgttttgaaagaaaccgatcaggaagagaatgagaaagta
ttgtcagcgttgaagcatggctttaaaacattactctgtgttggtgaaacgttagaacag
aaaaattatcagatttccgatgaagtacttcggacacaattaaagattggtttgcacggt
gtatcagtgaagcaattacctcatttattcattgcatatgaacccgtttgggcaattggt
gaaggtggtattcctgcaacggcgcaatatgcagatgagaaacagaagatcattaaacaa
tgtttatttgaaatgtttggtgaggaaagtaaaaagataccggtattgtatgggggaagt
gtgaatttagaaaatgcaaatgaattaattatgcagcctcatattgacggattgtttgtt
gggcgtagcgcctgggatgcacaatgtttttataccttaatagacggtgcgttaaaagcc
ttggcgggtacaacacatcaatttagccctattgctactcagctcattaaacacttagga
ggaaaagaaaatatcagtgcgttaacgcattgtgcgagtcggattagagtgatgacgcgg
aatgaaaatcatataaataaagtagcaatagaaaaaataaatggggtgagcgggttattt
tcgatcgctaatcaatatcaaattattgtaggtcctaaatgggtagaaaaaatttatagc
gaaatgaaagcgttattagaaacagaatag

DBGET integrated database retrieval system