KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_2219Help
Entry
PMCN06_2219       CDS       T01776                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMCN06_2219 (tpiA)
   01230 Biosynthesis of amino acids
    PMCN06_2219 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMCN06_2219 (tpiA)
   00051 Fructose and mannose metabolism
    PMCN06_2219 (tpiA)
   00562 Inositol phosphate metabolism
    PMCN06_2219 (tpiA)
Enzymes [BR:pmv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PMCN06_2219 (tpiA)
Exosome [BR:pmv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PMCN06_2219 (tpiA)
  Exosomal proteins of bladder cancer cells
   PMCN06_2219 (tpiA)
  Exosomal proteins of melanoma cells
   PMCN06_2219 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2321935..2322984
Genome map
AA seq 349 aa AA seqDB search
MEKKIYFGTNLKMYKGNCETVDYLTQLLALREKLQSDYDIELFVIPSYIALKDAVHAAAS
ETTHKILIGAQNMNAKDKGQFTGEISPLMLKELGVQLVMIGHSERRHVLKETDQEENEKV
LSALKHGFKTLLCVGETLEQKNYQISDEVLRTQLKIGLHGVSVKQLPHLFIAYEPVWAIG
EGGIPATAQYADEKQKIIKQCLFEMFGEESKKIPVLYGGSVNLENANELIMQPHIDGLFV
GRSAWDAQCFYTLIDGALKALAGTTHQFSPIATQLIKHLGGKENISALTHCASRIRVMTR
NENHINKVAIEKINGVSGLFSIANQYQIIVGPKWVEKIYSEMKALLETE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaatttactttggtacaaatttaaaaatgtataaaggtaattgtgaaaca
gtcgattaccttactcagttacttgccctcagagaaaaacttcaatctgattatgatatt
gaattatttgtcattccttcttatatcgccttaaaagatgctgtacatgcagcggcatca
gagacaacgcataaaattcttattggtgcacagaacatgaatgctaaggataaggggcag
tttactggcgaaatttcaccactcatgttgaaagagctaggggttcagttggtcatgatt
gggcattctgaacgtcgccatgttttgaaagaaaccgatcaggaagagaatgagaaagta
ttgtcagcgttgaagcatggctttaaaacattactctgtgttggtgaaacgttagaacag
aaaaattatcagatttccgatgaagtacttcggacacaattaaagattggtttgcacggt
gtatcagtgaagcaattacctcatttattcattgcatatgaacccgtttgggcaattggt
gaaggtggtattcctgcaacggcgcaatatgcagatgagaaacagaagatcattaaacaa
tgtttatttgaaatgtttggtgaggaaagtaaaaagataccggtattgtatgggggaagt
gtgaatttagaaaatgcaaatgaattaattatgcagcctcatattgacggattgtttgtt
gggcgtagcgcctgggatgcacaatgtttttataccttaatagacggtgcgttaaaagcc
ttggcgggtacaacacatcaatttagccctattgctactcagctcattaaacacttagga
ggaaaagaaaatatcagtgcgttaacgcattgtgcgagtcggattagagtgatgacgcgg
aatgaaaatcatataaataaagtagcaatagaaaaaataaatggggtgagcgggttattt
tcgatcgctaatcaatatcaaattattgtaggtcctaaatgggtagaaaaaatttatagc
gaaatgaaagcgttattagaaacagaatag

DBGET integrated database retrieval system