KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_p03Help
Entry
PMCN06_p03        CDS       T01776                                 

Gene name
sulII
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMCN06_p03 (sulII)
Enzymes [BR:pmv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PMCN06_p03 (sulII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:1422..2237
Genome map
AA seq 271 aa AA seqDB search
MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVS
SDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAK
SSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFF
LGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAA
GGADFIRTHEPRPLRDGLAVLAALKETARIR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgctcatcattttcggcatcgtcaacataacctcggacagtttctccgat
ggaggccggtatctggcgccagacgcagccattgcgcaggcgcgtaagctgatggccgag
ggggcagatgtgatcgacctcggtccggcatccagcaatcccgacgccgcgcctgtttcg
tccgacacagaaatcgcgcgtatcgcgccggtgctggacgcgctcaaggcagatggcatt
cccgtctcgctcgacagttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtg
gcctatctcaatgatattcgcggttttccagacgctgcgttctatccgcaattggcgaaa
tcatctgccaaactcgtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgag
gcacccgctggcgacatcatggatcacattgcggcgttctttgacgcgcgcatcgcggcg
ctgacgggtgccggtatcaaacgcaaccgccttgtccttgatcccggcatggggtttttt
ctgggggctgctcccgaaacctcgctctcggtgctggcgcggttcgatgaattgcggctg
cgcttcgatttgccggtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcaca
ggccgtggtccgggggatgtcggggccgcgacactcgctgcagagcttgccgccgccgca
ggtggagctgacttcatccgcacacacgagccgcgccccttgcgcgacgggctggcggta
ttggcggcgctgaaagaaaccgcaagaattcgttaa

DBGET integrated database retrieval system