KEGG   Paenibacillus mucilaginosus K02: B2K_00960Help
Entry
B2K_00960         CDS       T02041                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2K_00960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_00960
   00052 Galactose metabolism
    B2K_00960
   00500 Starch and sucrose metabolism
    B2K_00960
   00520 Amino sugar and nucleotide sugar metabolism
    B2K_00960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B2K_00960
   00524 Butirosin and neomycin biosynthesis
    B2K_00960
Enzymes [BR:pmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B2K_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215514..216467
Genome map
AA seq 317 aa AA seqDB search
MGDQVYVGVDLGGTAIKVGLCDEQGKLLQTYEGPTGTEHGADVVLENIAQYVRKLVAESP
YEWEQVAGVGAGIAGFMDIPEGFMKLSPNLGWRNVPVKKILEEKLGVPVKIDNDANVAAL
GEAWSGAGAGIPNVVCYTLGTGVGGGIIIHSRIYQGSNGMAGELGHMVVVPDLEAIECGC
GKKGCLETVSSGTGIIRMAKEAVARGEHTSLALVENIMAKDVFDAAKTGDETALRIINRA
ALYLGKSMAAVSVVLNPKRFIVGGGVSKAGDILFDAIRKYYQEFTQETAQEGVDIVPAVL
GNDAGVVGAAGLNLHSI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggagatcaagtgtacgtaggagtcgatttgggaggaaccgcgattaaagtgggattg
tgcgacgagcagggcaagcttctgcagacgtacgaaggcccgaccggtaccgaacacggc
gcggatgtcgtgctggagaatatcgcacaatatgtgcgcaagctggtggcggaatcccct
tatgagtgggagcaggttgccggagtcggtgcggggatcgccgggtttatggatattccg
gaaggcttcatgaagctgtctcccaacctgggctggcgcaatgttccggtgaagaagatt
ctcgaggagaagctcggcgtgcctgtcaaaatcgacaacgacgccaatgtagcggcactc
ggcgaagcatggagcggagcgggtgcaggcattccgaacgtcgtctgctatacgcttgga
acaggcgttggcggtggcattatcatccacagccggatttatcagggctccaacggcatg
gcaggagagcttggccatatggtggtcgtaccggacctggaagcgatcgagtgcggatgc
ggtaagaagggctgcctcgagaccgtatcttcgggaacgggcattattcgcatggccaaa
gaagccgtggcgcgtggagagcatacttccctggccctggtggagaacatcatggcgaag
gacgtattcgatgcggcgaagaccggcgacgaaaccgcactgcggatcattaaccgggca
gcgctgtacctgggcaaatcgatggcggcggtatccgtcgtgctgaacccgaagcggttc
atcgtgggcggcggggtgtccaaagccggtgatattctgttcgatgccattcgtaagtat
taccaggaattcacgcaggagactgcgcaggaaggcgtggatattgttccggccgtgctc
ggcaacgatgccggcgtagtgggcgcagcaggactgaatctgcacagcatctaa

DBGET integrated database retrieval system