KEGG   Paenibacillus mucilaginosus K02: B2K_01015Help
Entry
B2K_01015         CDS       T02041                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2K_01015 (tpiA)
   01230 Biosynthesis of amino acids
    B2K_01015 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_01015 (tpiA)
   00051 Fructose and mannose metabolism
    B2K_01015 (tpiA)
   00562 Inositol phosphate metabolism
    B2K_01015 (tpiA)
Enzymes [BR:pmw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B2K_01015 (tpiA)
Exosome [BR:pmw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B2K_01015 (tpiA)
  Exosomal proteins of bladder cancer cells
   B2K_01015 (tpiA)
  Exosomal proteins of melanoma cells
   B2K_01015 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
228015..228767
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMFKTVQEAVSFVNEVKGKAEVEGVESVICSPFTNLPALVEAVKGTTLKV
GAQNLHFEDNGAYTGEISGVMLKDLGVEYVIIGHSERRAYFSETDEIVNKKVQAAFKHGL
TPIVCVGEKLEEREANQTKDVCKVQTEGAFAGLSAEQAAQVVIAYEPIWAIGTGKSSTAA
DAQDVIGYIREVVSGLYGAETAAAVRIQYGGSVKPNNIAEYMQQPDIDGALVGGASLEPA
SYIALIEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccgattattgcaggcaactggaaaatgttcaaaaccgtgcaggaagccgtt
tctttcgtgaacgaagtaaaaggcaaagcggaagtggaaggcgtggagagcgtcatctgc
tccccgttcacgaatcttcctgccctggtggaagcggtgaaaggcacgacgctcaaagtc
ggcgcccagaaccttcacttcgaagacaacggtgcttacacgggtgagatcagcggcgtt
atgctgaaggatctcggcgtagagtacgtcatcatcggacactccgagcgccgggcttac
tttagcgagacggacgagatcgtgaacaagaaggtccaagcggcattcaaacacggtctg
actccgatcgtctgcgtaggcgagaagctcgaagagcgcgaagcgaaccagaccaaggac
gtatgcaaagtgcagaccgaaggcgcattcgcaggcctgagcgcagaacaggcggcacag
gtggtcatcgcctatgagccgatctgggctatcggaacaggcaagtcttctacagctgca
gacgctcaagacgtgatcggctacatccgtgaagtcgtaagcggcctgtatggcgctgag
acggctgcagcggtacgcatccagtacggcggcagcgtgaagccgaacaatatcgcggaa
tacatgcagcagccggatatcgacggcgcgcttgtaggcggagcttccctggagccggcc
tcctacatcgccctgatcgagggggccaagtaa

DBGET integrated database retrieval system