KEGG   Paenibacillus mucilaginosus K02: B2K_01040Help
Entry
B2K_01040         CDS       T02041                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Brite
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     B2K_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioesterase DUF1057 DLH PGAP1 Esterase Peptidase_S9 Abhydrolase_2 Ser_hydrolase UPF0227 Abhydrolase_3 Lipase_3 LIDHydrolase Abhydrolase_5
Motif
Other DBs
NCBI-ProteinID: AFH59327
UniProt: I0BAD0
Position
233182..233985
Genome map
AA seq 267 aa AA seqDB search
MTRQYRTTEPFHLEGTGERASTELLLIHGFTGSPSEFRRLGYYLNDLGYTVRGILLPGHG
TTPEDMIRTGLNDWSRHVTESFDTIRAQGGPDRRIVAVGHSMGGLLALKLAMERPLAGVV
SLAAPIFLASRKTVLAVLLQYFVKYVERRPTVPPHIIEEACSYSRTPIPCVVDLRKLLKH
VKTSLNEVKAPLFIGQGGRDKLVLPRSAEYIYRHVSSAFRQMAHYPSTSHAILLDEERER
VYADIHRFLVTLEHIGTWEQTAAGYAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcggcagtatcgaacaacggagccctttcacctggagggaacgggagagcgggca
tctacggaactcctgcttatccacgggtttaccggttcgccttcggagttccgccgcctg
ggctactacttgaacgatctgggctataccgtaagggggatcctgctgccgggccacgga
acgacgcccgaggatatgatccgtacggggctgaacgactggtccaggcatgtgacggag
agcttcgataccatccgggcgcagggcggtccggatcggcggatcgtagccgtaggacat
tcgatgggcggtctcctggccttgaagctggcgatggagcgtccgctggccggggtcgtc
tccctcgccgcaccgatcttcctggcctcgcgcaagaccgtactcgccgtgctgctgcag
tattttgtgaagtatgtggagcggcgtccgaccgtcccccctcatatcatcgaggaagcc
tgctcctacagccgtacgccgattccttgtgtcgtggatttgcgcaagctgcttaagcac
gtcaaaaccagtttaaatgaagtaaaagccccgctttttatcggacaagggggaagggac
aagcttgtgctgccgcgcagtgcggagtacatctaccgccatgtctcctcggccttccgg
cagatggcccattacccctccacctcgcatgccatcctgctggatgaggagcgggagcgg
gtatacgcggatattcaccgatttctggtgacgcttgagcatatagggacatgggaacaa
acggcggcggggtatgcgccataa

DBGET integrated database retrieval system