KEGG   Paenibacillus mucilaginosus K02: B2K_01040Help
Entry
B2K_01040         CDS       T02041                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233182..233985
Genome map
AA seq 267 aa AA seqDB search
MTRQYRTTEPFHLEGTGERASTELLLIHGFTGSPSEFRRLGYYLNDLGYTVRGILLPGHG
TTPEDMIRTGLNDWSRHVTESFDTIRAQGGPDRRIVAVGHSMGGLLALKLAMERPLAGVV
SLAAPIFLASRKTVLAVLLQYFVKYVERRPTVPPHIIEEACSYSRTPIPCVVDLRKLLKH
VKTSLNEVKAPLFIGQGGRDKLVLPRSAEYIYRHVSSAFRQMAHYPSTSHAILLDEERER
VYADIHRFLVTLEHIGTWEQTAAGYAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcggcagtatcgaacaacggagccctttcacctggagggaacgggagagcgggca
tctacggaactcctgcttatccacgggtttaccggttcgccttcggagttccgccgcctg
ggctactacttgaacgatctgggctataccgtaagggggatcctgctgccgggccacgga
acgacgcccgaggatatgatccgtacggggctgaacgactggtccaggcatgtgacggag
agcttcgataccatccgggcgcagggcggtccggatcggcggatcgtagccgtaggacat
tcgatgggcggtctcctggccttgaagctggcgatggagcgtccgctggccggggtcgtc
tccctcgccgcaccgatcttcctggcctcgcgcaagaccgtactcgccgtgctgctgcag
tattttgtgaagtatgtggagcggcgtccgaccgtcccccctcatatcatcgaggaagcc
tgctcctacagccgtacgccgattccttgtgtcgtggatttgcgcaagctgcttaagcac
gtcaaaaccagtttaaatgaagtaaaagccccgctttttatcggacaagggggaagggac
aagcttgtgctgccgcgcagtgcggagtacatctaccgccatgtctcctcggccttccgg
cagatggcccattacccctccacctcgcatgccatcctgctggatgaggagcgggagcgg
gtatacgcggatattcaccgatttctggtgacgcttgagcatatagggacatgggaacaa
acggcggcggggtatgcgccataa

DBGET integrated database retrieval system