KEGG   Paenibacillus mucilaginosus K02: B2K_01555Help
Entry
B2K_01555         CDS       T02041                                 

Definition
(GenBank) phosphoglycerate kinase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00010  Glycolysis / Gluconeogenesis
pmw00260  Glycine, serine and threonine metabolism
pmw00680  Methane metabolism
pmw01100  Metabolic pathways
pmw01110  Biosynthesis of secondary metabolites
pmw01120  Microbial metabolism in diverse environments
pmw01130  Biosynthesis of antibiotics
pmw01200  Carbon metabolism
pmw01230  Biosynthesis of amino acids
Module
pmw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmw_M00002  Glycolysis, core module involving three-carbon compounds
pmw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_01555
  Energy metabolism
   00680 Methane metabolism
    B2K_01555
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_01555
Enzymes [BR:pmw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     B2K_01555
Membrane trafficking [BR:pmw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    B2K_01555
Exosome [BR:pmw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   B2K_01555
  Exosomal proteins of melanoma cells
   B2K_01555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFH59424
UniProt: I0BAM7
Position
complement(356021..356623)
Genome map
AA seq 200 aa AA seqDB search
MTGVITTVYFVRHADSPYSAERERERGLSAAGEEAARRAALLLEDEGIGFLVSSPYRRAV
LTLQPLADRLGLPVAEEEDLRERKLSAEPLFPSREAFFEAKRSLFADPQLRYPGGESSEE
ARQRGTAVLRGLLLRHRGSRLALGTHGDIMTLMLGAWDPAYGFRFWQSTSMPDIYKAEFM
EDAAGPCLYAVTRLWRGPGA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggtcatcaccaccgtttatttcgtacgtcatgccgattccccctactccgcc
gagcgggagcgcgagcgcggattgtctgcggccggagaagaggccgcccggagagccgcc
ctgcttcttgaagacgaagggatcggcttcctcgtctcgagcccctatcggcgggctgtc
ctgacgctccagccgctggccgaccgtctcggactgcccgtcgcggaggaggaggatctc
cgggagcgcaagctgtccgcggagcctctgttcccatcgcgggaagccttcttcgaagcg
aagcgctccctcttcgcggacccgcagctccggtaccccggcggcgagtcaagcgaagaa
gcccggcagcgggggacagccgtcctccgcggtctgctgctccgtcaccggggcagcagg
cttgccctcggtacgcacggcgacatcatgaccttgatgctcggagcctgggaccccgct
tacggcttccgcttctggcagagcacgtccatgccggatatttataaagcggagttcatg
gaggatgccgcaggtccgtgcctgtacgccgttacccgcctgtggcggggaccaggagcc
taa

DBGET integrated database retrieval system