KEGG   Paenibacillus mucilaginosus K02: B2K_02480Help
Entry
B2K_02480         CDS       T02041                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B2K_02480
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     B2K_02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571247..571837
Genome map
AA seq 196 aa AA seqDB search
MPAKEYRNNRVIENREQIEHHVREILRLIGEDVDREGLHDTPARVTRMYEEIFAGYEADV
KDILGVAFDEKHEELVIVKDIVYYSQCEHHMAPFFGRIHIGYIPSGKIAGLSKFARLVEA
VTRRLQVQERITSELADIIEGELEPHGCMVVVEGEHLCMCARGVKKPGSKTISSAVRGVF
RTDASSRAEFLSLIKD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaaagaatacagaaataaccgcgtgatcgagaaccgcgaacagatcgagcac
catgtccgcgagattcttcggttgatcggtgaagatgtggaccgtgaaggtctgcatgac
accccggcacgcgtaacacgcatgtatgaagagattttcgcaggctatgaagccgatgtc
aaagacatcctcggcgtggcattcgacgagaagcacgaagagctggtcattgtcaaagat
atcgtctactacagccagtgcgagcaccatatggcgcctttcttcgggcggatccatatc
ggatatatcccgagcgggaagatcgcgggactgagcaaattcgcgcgtctggtggaggcc
gtcacccgccgcctccaggtgcaggaacgcattacctcggagctcgccgacatcatcgaa
ggggagctggagccccacggctgcatggtcgtggtggaaggcgagcatctgtgcatgtgc
gcccgcggcgtcaagaagccgggcagcaagacgatctcctcggctgtgcgcggcgtattc
cgtacggatgcgtcctcccgtgccgagttcctgtccctgatcaaggactag

DBGET integrated database retrieval system