KEGG   Paenibacillus mucilaginosus K02: B2K_02865Help
Entry
B2K_02865         CDS       T02041                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:pmw00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pmw00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668445..668993
Genome map
AA seq 182 aa AA seqDB search
MNIIQTKLDGVVIIEPAVFGDNRGFFMETFSAQKLKEAGLEYPFVQDNHSLSVEAGVLRG
LHYQLNPKAQTKLVRVAAGAIYDVAVDIRKNSPTYGQWVGVILSAENKRQLLVPQGFAHG
FCTLVPNTEVLYKVDQYYSPEHDRGIAWNDPALGIDWPVSKPVLSDKDGKHPLLADAENN
FE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatattattcaaaccaagttggatggagtcgtcattatcgaaccggctgtatttgga
gacaaccggggtttcttcatggaaacgttcagtgcccagaagctgaaagaagcaggttta
gaatatcccttcgtacaggacaaccactctctatccgttgaagcgggtgtgcttcgcggt
ctgcattatcagttgaatcccaaagcccaaacgaagcttgttcgtgtagcggccggggct
atctatgatgtggcagtggatattcgtaagaattccccaacctatggtcagtgggttggt
gtcattttgagcgcagaaaataaacgtcaactgctggtcccgcaggggtttgctcacggc
ttctgtaccctggtaccgaatacggaagtattgtacaaggtagaccagtactactcgcct
gagcatgaccggggcattgcgtggaacgatccagctcttggaatcgactggccggtatcc
aaacccgtgctgtcggacaaggatgggaagcatccgcttctcgccgacgctgaaaacaac
ttcgaataa

DBGET integrated database retrieval system