KEGG   Paenibacillus mucilaginosus K02: B2K_03100Help
Entry
B2K_03100         CDS       T02041                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    B2K_03100
  Lipid metabolism
   00561 Glycerolipid metabolism
    B2K_03100
   00600 Sphingolipid metabolism
    B2K_03100
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     B2K_03100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721793..723298
Genome map
AA seq 501 aa AA seqDB search
MSFKIAFIGAGSVGFTRGLLRDLLSVPEFHEVEIAFMDTSERNLEMVRQLCQRDILENGL
QIQIQATTDRREALRDAKYVLCTIRVGGLEAFATDVDIPLRYGIDQCVGDTLCAGGIMYG
QRGIAEMLKICKDIREVAREDVLLLNYANPMAMLTWACNAYGGVRTVGLCHGVQNGHRQI
AEAFGLEKEEVDIICAGINHQTWYVQIRHNGEDLTGRLLEAFEAHPEFNRTEKVRIDMLR
RFGYYSTESNGHLSEYVPWYRKRPEEIGEWIDLGSWINGETGGYLRVCTEGRRWFETDFP
NWLKEPALEYTPEKRGEEHGSYIIEGLETGRVYRGHFNVVNRGVISNLPDDAVIEAPGYV
DRSGISMAHVGSLPLGPAAVCNASISVQRLAVEAAVHGDDQLLRQAMLLDPLVGAVCNPR
EVWQMTDELLVAQEAWLPQYGAAIAEAKARLAEGLQVPVRDYRGAARLHVKTVEEMEANR
EQASRNAGESDKGKERAAAAQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaaaattgcttttatcggtgccggcagtgtcggatttactcgggggctgctg
cgtgatctgctgtccgtgccggagttccatgaggtggagatcgcttttatggatacgagt
gaacggaacctggagatggtccgccagctctgtcagcgggatattctggagaacgggctt
caaatccaaatccaggcgactacagaccgcagggaagcgctgagggatgccaagtatgtg
ctgtgcacgatccgggtcggcgggctggaggcgttcgcgacggatgtggacatcccgctg
aggtacgggatcgaccagtgcgtcggggacacgctctgtgcgggcggcattatgtacggt
cagcggggcattgccgagatgctgaagatctgcaaggacatccgggaggtggcgcgggag
gacgtgctgctgctcaactatgccaacccgatggccatgctgacctgggcctgcaatgcg
tacggcggcgtgcggaccgtcggtctgtgccatggcgtgcagaatggacaccggcagatt
gcggaggccttcgggctggagaaggaagaggtcgatatcatctgcgcgggcatcaaccac
caaacctggtatgtgcagatccgccataacggagaagatcttaccggccggctgctggag
gccttcgaggcgcatccggaattcaaccgaacggagaaggtgcgcatcgatatgctgagg
cgcttcggttattacagcacggaatcgaacggccacctcagcgagtacgtgccgtggtac
cgcaagcgtccggaggagatcggggagtggatcgacctcggctcctggatcaacggggag
accggcggttatcttcgcgtctgcacggaagggcggcgctggttcgagacggacttcccg
aactggctgaaagagcctgcactggaatatacgccggagaagcgcggggaggagcacggt
tcttatatcatcgagggcctcgagaccggccgggtctaccgggggcacttcaacgtagtc
aaccggggcgtaatctccaatctgccggacgatgccgtcatcgaagcgccgggctatgtc
gaccgcagcggcatctcgatggcgcatgtcggaagcttgccgctggggccggccgccgta
tgcaatgcaagcatctccgttcagcggcttgctgtggaagcggcggtccacggggatgat
cagctgctgcggcaggcgatgctgctggaccccctcgtgggggcggtctgcaacccgcgg
gaagtgtggcagatgaccgacgagctgctggtcgcccaggaggcgtggctgccgcagtac
ggcgctgcgatcgccgaggccaaagcgcggctcgccgagggactgcaggtgcccgtacgc
gactaccgcggagcggcccgcctccacgtgaagaccgtggaggagatggaagcgaaccgc
gagcaggccagccggaatgcgggagagtccgacaagggcaaggagcgggccgcagcggcg
cagtaa

DBGET integrated database retrieval system