KEGG   Paenibacillus mucilaginosus K02: B2K_04230Help
Entry
B2K_04230         CDS       T02041                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pmw  Paenibacillus mucilaginosus K02
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
984562..985686
Genome map
AA seq 374 aa AA seqDB search
MKRTWNIAVTSLLTINLLAAASFAEFTASTAMAATAVKSSAATSSVAKTSNKKEQKAVTL
KEAAQAKGKHIGVATQSWLVNKSEYAAVLNQEFDTITPEYQMKMGVIQKQKGIYNFSEAD
ALVDFALKNNKIVRGHTLVWHSSLPSWVENGKFTREEWIAILKDHITKTVQHFKGKVYGW
DVVNEAFWQNGQYRPTVWYNNIGPEYIEMAFRFAHEADPQAKLYYNDFSSEVKNEKSDAI
YKMLKDLKSKGVPIDGIGFQTHLTIDGLNYNDMKTNFQRFAALGLDTDITEMDLVTHTFQ
GTMEQKMNAAAAVYGNVMKVALSLPSCKFFIAWGLNDSQSWLNEDTGFSEYPLLFDDSFG
KKPAYNAVMEQLRK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaacatggaacattgcagttacttccctgcttacgataaatctgcttgccgcg
gcttcctttgctgaatttaccgcttcgacagccatggctgccaccgcagtcaaatcttcc
gccgccacatcttccgttgccaagacttcgaacaagaaggaacagaaggcggttacgctc
aaggaagcggctcaagcgaaaggaaagcatatcggtgtagcgacgcagagctggctcgtt
aacaaaagcgaatatgcggccgtgctcaatcaagagtttgatacgatcacaccggagtac
cagatgaagatgggtgtgattcagaagcaaaaaggaatctataacttcagcgaagccgat
gcgctggtggacttcgccctgaagaacaataaaattgtaagaggccatacgctggtatgg
catagttccctcccatcctgggtggaaaacggcaagtttacaagggaagaatggatcgcc
attctcaaggaccacatcacaaagaccgttcagcacttcaaaggcaaggtttacggatgg
gacgtagtgaacgaagccttctggcagaacggccagtaccgtccgaccgtgtggtacaac
aatatcggaccggagtatatcgagatggcattccgctttgcccatgaagcagacccgcag
gcgaagctgtactacaacgacttcagctcggaagtgaagaatgaaaagtccgacgcgatc
tacaaaatgctgaaggatctgaagagcaaaggggtaccgatcgacggaatcggattccag
acgcacctgacaattgacggcctgaactacaatgacatgaaaaccaacttccagcgcttc
gcggcactcgggctcgacaccgatattacggagatggatctcgtgactcatacgttccag
gggacgatggaacagaagatgaatgcggccgcagcggtatatggtaacgtcatgaaagtg
gcactcagcctgccgagctgcaaattctttatcgcgtggggcctgaacgacagccaaagc
tggctgaatgaggataccggcttcagtgagtaccctctgctcttcgacgattccttcggg
aagaagccggcttacaatgcggttatggagcagctcagaaaataa

DBGET integrated database retrieval system