KEGG   Paenibacillus mucilaginosus K02: B2K_04250Help
Entry
B2K_04250         CDS       T02041                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B2K_04250
   00052 Galactose metabolism
    B2K_04250
   00500 Starch and sucrose metabolism
    B2K_04250
   00520 Amino sugar and nucleotide sugar metabolism
    B2K_04250
Enzymes [BR:pmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B2K_04250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
989168..990049
Genome map
AA seq 293 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKGK
RAIEDHFDNYFELEANLQEKGKLDLLAEVRYPTSMADIHYIRQKEPKGLGHAIWCARKFI
GDEPFAVLLGDDIVVSEKPCLQQMIEIFDTYQVSVLGVQNVEPETVSRYGIVDGMQLEDR
VTRVTRLVEKPKREEAPSTQAILGRYILTPRIFDVLENQATGAGGEIQLTDAIAALNRME
AVYAYEFEGTRYDVGEKLGFIQTMLDFSLQRPDLREDVLAYMQKIVEQAAQLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcaagaaggccatcattcccgcagcaggacttggaacccggttcctgcctgca
accaaagccatgccgaaggaaatgcttccgatcgtggacaagcccacgatccaatacatt
gtagaggaagccgttgcctcgggtattgaggatatcattatcgtaacaggaaaaggcaag
cgggcgatcgaggatcatttcgataactattttgaactcgaagccaatctgcaggagaag
ggcaagctggatctgcttgccgaagtccgttatccgacctccatggcggatatccattat
atccggcagaaggagcccaaaggactgggacatgccatctggtgcgcacggaagtttatc
ggcgacgagccgtttgcggtcctgctgggagatgacattgtcgtctccgagaagccctgc
ctgcagcagatgatcgaaatcttcgatacttaccaggtatccgtactgggtgttcagaat
gtggagcctgagacggtatcccggtatgggatcgtagacggcatgcagcttgaggaccgc
gttacccgtgtaacccggctcgttgagaagccgaagcgcgaggaggccccgtccactcag
gcgatcctcggacgctatattttaacgccgcggattttcgatgtgctcgagaatcaggct
acgggtgcaggcggggaaattcagctcacggatgcgatcgcagcgctgaaccggatggaa
gccgtctatgcttacgagttcgaaggcacgcggtatgacgtgggcgagaagctgggcttt
atccagacgatgctggatttctccctgcagcggccggatctgcgcgaagatgttctggct
tatatgcagaagatcgtggaacaggccgcccaattgaagtaa

DBGET integrated database retrieval system