KEGG   Paenibacillus mucilaginosus K02: B2K_04320Help
Entry
B2K_04320         CDS       T02041                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmw00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pmw00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003273..1003782
Genome map
AA seq 169 aa AA seqDB search
MTVSYMFAMDEARGLGYQNRMPWYLPADFAYFKQTTLEHTVLMGRKTFDSLGGKPLPRRR
NVILTRDKSFEAPGCETVTSPEDAVKPYRPGGEQADEELFVIGGAEIFSLLMPYADRMYI
TEIHHTFEVDTYFPELDRTEWKEVSRTKGPKDERNPYDYEFVIYERAAN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacggtttcttatatgttcgcaatggatgaagcccgggggctggggtaccagaatagg
atgccctggtatttgccggccgattttgcctattttaagcagaccaccctggagcatacg
gtgctcatgggacgcaaaaccttcgattcgctgggaggcaaaccgcttccgcggcgccgc
aatgtgattctcacaagggacaagtccttcgaggcaccgggctgtgagaccgtgacgtct
ccagaggatgcggtgaagccgtaccgccccggaggagaacaagcggacgaggagctgttc
gtgatcggcggagcggagattttctccctgctgatgccgtacgccgaccgcatgtacatc
acggagattcaccatacgttcgaggtggacacttacttcccggagcttgaccggacggag
tggaaggaagtgtcccgcacgaaagggcctaaggatgagaggaacccttacgattatgaa
tttgtcatctacgaacgggcggcgaactag

DBGET integrated database retrieval system