KEGG   Paenibacillus mucilaginosus K02: B2K_05660Help
Entry
B2K_05660         CDS       T02041                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pmw00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1278073..1279947
Genome map
AA seq 624 aa AA seqDB search
MCGITGVMYFEDRVPSPSLLKSMTDCIEHRGPDDIGFWSESRIGLGFRRLSIIDLKEGHQ
PLANEDDTVWIAFNGEIYNYKYLRDTLQAKGHQFKTHSDTEVIVHMYEEYGEDCVKQLRG
MFGFVIWDKRKQRLFGARDHFGIKPFYYRKDGSRFLFGSEIKSILAAGVERTIHTESLLN
YLTFQYVPEPTTMFEGIFKLPPGHSITVTADGQMNIRQYWDSMLEPQEQSLESCIEQIRE
KLQDSVVHHMQSDVERGCFLSSGIDSTAIAAHMRRIEPIRTFSVGFEGANNETIIARQTA
QALGTEHYEKVITQEDYFATLPKAVWHQDEPVADPSAIALYHVAQLARQHVTVVLSGEGA
DELFGGYRIYNEPNSLAPIERMPYPVKRMLNALARLLPEGVKGRNYLLRGTTPLEQRFLG
NAKIFSEDMKAELVRVDREMLRSYKNPVEIAKKFYDKSAHLDPVSRMQYIDMNLWMPGDI
LMKADKMTMAHSIELRVPFLDVELYEVSRRIPAKHRIAGGTTKYVFRKAMEGIIPDNILN
RPKLGFPVPMRDWMKGPQGNVIMEQIAGSGIEDYIRMDTVRNMLSAHRSGQGDYARRIWT
VYMFALWHGTYMEELPSPSLAHAQ
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatcaccggcgtgatgtattttgaggaccgggtaccgtccccgtccctgctg
aagagcatgaccgattgtattgagcaccggggaccggacgatatcggattttggagcgag
agccgcatcgggctgggatttcgccgcctgtccatcatcgacctgaaagaaggccaccag
ccgctggccaatgaagacgacacggtatggatcgcgttcaacggcgagatctataactat
aaatacctgcgcgacacgctgcaggccaaagggcatcagttcaagacgcacagcgacacc
gaggttattgtacatatgtacgaagaatacggcgaggactgcgtgaagcagctccgcggg
atgttcggcttcgtgatctgggacaagcgcaagcagcgtctgttcggtgcacgggaccac
ttcggcatcaagccgttctattaccgcaaggacggcagccggttcctgttcggctcggag
atcaagagcatcctggccgccggcgtggagcgcacgattcacacggagagcctcctcaac
tatctgacgttccagtatgtgccggagccgacgacgatgttcgagggcatctttaagctg
ccgccgggacacagcatcacggtgacggcagacggccaaatgaatatccgccagtattgg
gactccatgctggagccgcaggagcagtccctggaatcctgcatcgagcagatccgggag
aagctgcaggactccgtcgtccaccacatgcagagtgacgtggagcgcggctgcttcctc
tccagcgggatcgactccaccgcgattgccgcccacatgcggcgcatcgaaccgatccgc
accttctcggtcggcttcgaaggggcgaacaacgagacgatcatcgcccggcagacggcc
caggccctcgggaccgagcactacgagaaggtcatcacgcaggaggactactttgcgacg
ctgccgaaggcggtatggcatcaggacgagccggtagccgacccgtcggcgattgcgctc
taccacgtcgcacagctggcacgccagcatgtgacggtcgtcctctccggcgagggggcg
gacgagctgttcggcggctaccgcatctacaacgagccgaactcgctggctccgattgag
cggatgccctatccggtgaagcggatgctgaacgcgctggcccgtctgctgccggaaggc
gtcaagggacgcaactacctgctgagggggacgacaccgctcgagcagcgtttcctcggc
aacgcgaagattttcagcgaggacatgaaggccgagctcgtgcgcgtcgaccgcgagatg
ctgcgcagctacaagaatccggtggagatcgccaagaagttctatgacaagagcgctcac
ctcgatccggtctcccggatgcagtacatcgatatgaacctgtggatgccgggagacatt
ctgatgaaggcggacaaaatgacgatggcgcactcgatcgagctccgggtgccgttcctc
gacgtggagctgtacgaagtgtcccgccgcatcccggcgaagcaccggattgccggcggc
accacgaagtatgtgttccgcaaggcgatggagggcatcattccggacaatatcctgaac
cggccgaagctcgggttccccgtaccgatgcgcgattggatgaagggcccgcaggggaat
gtcatcatggaacagatcgcaggcagcggcattgaggattacatccgcatggacaccgta
cggaacatgctgtccgcgcaccgcagcggccagggcgattacgcccgccgcatctggacc
gtctatatgttcgcgctctggcacggcacctacatggaggagctgccgagcccttcgctc
gcgcacgcccagtag

DBGET integrated database retrieval system