KEGG   Paenibacillus mucilaginosus K02: B2K_06855Help
Entry
B2K_06855         CDS       T02041                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B2K_06855
Enzymes [BR:pmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B2K_06855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1537822..1538691
Genome map
AA seq 289 aa AA seqDB search
MDLVVSMPRMPQVGETVHGTDIHYIPGGKGANQAVGCARLGAEVSMIGAVGSDHFGREML
ERLQEEGIDLGGVHTAEGPTGTAAIFHTAEDNCIAVVPGANAYCTPELVERHRERIESAD
VLLVQLEVPLDTVHRALEIARQAGVRTVLNPAPAKVLPAPLLSLADILTPNETEFALLSG
EQDTSEEVLRRVMIAWQQDYGHTVILTRGRLGSSWLDEGERLRTEPALPVETVDTTGAGD
AFNAALCFGLASGWDLQQAADFACRAASVSVTRFGAQAGMPRLEEVPER
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtcgtatccatgccgcggatgccgcaggtgggggagaccgtccatggtacg
gatatccactatatcccgggaggcaagggagcgaaccaggcggtcggctgcgcccgtctc
ggcgcggaggtatcgatgatcggagcggtggggagcgatcattttggccgggagatgctg
gagcgactgcaggaggagggcatcgacctcggcggtgtccatacggccgaggggcctacg
ggaaccgcagcgatcttccataccgcggaggataactgcatcgccgtcgttccgggggcg
aacgcctattgcacgccggagctcgttgaacggcacagggagcggatcgagtcggccgac
gtgctgctggtccagctggaggtgccgctggataccgtgcaccgggccctggagatcgcc
cgtcaggccggcgtgcgcaccgtgctcaacccggctccggccaaggtgctgccggctccg
ctattgtcgctggcggacatcctgacgccgaatgagaccgaattcgccctgctcagcggg
gagcaggatacctcggaagaggtgctgcgccgggttatgatcgcctggcagcaggattac
ggccatacggtgatcctgacgcgaggacggctgggcagctcctggctggatgagggagag
cgcctgcgcaccgagccggccctgcccgtcgagacggtggatacgaccggagcaggcgat
gccttcaatgcagcgctgtgcttcggcctggcttccggctgggacctgcagcaggccgcc
gattttgcctgccgggccgcatcggtatccgtcacccgcttcggcgcccaggccggcatg
ccccgcctggaggaagtgccggagcggtag

DBGET integrated database retrieval system