KEGG   Paenibacillus mucilaginosus K02: B2K_06990Help
Entry
B2K_06990         CDS       T02041                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pmw  Paenibacillus mucilaginosus K02
Brite
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     B2K_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1576389..1577405
Genome map
AA seq 338 aa AA seqDB search
MEQRRQDQITVIPSLKEVYADRFAIGAAVSPQTIVTQKELLAAHYGSLTAENEMKPVSVQ
PEEGRFTFEDADRIARFAEEHGMQMRGHTLVWHNQTPDWMFVDGQGQPAGRDLVLQRMKD
HIGAVVGRYKDRIKVWDVVNEAVSDEGPQLLRPSKWLETAGEEFIRRAFEYAHEADPDAL
LFYNDYNECHPDKRDRIHRLLKSLKEQGTPVQGMGMQGHWSLQRPSADEIRAAVELYASL
DLQLHITELDVSVFEWDDKRTDLLEPTAEMLEAQERRYEEIFGLLREYSGVITSVTFWGA
ADDYTWLDHFPVRSRKNWPFLFDRNHQPKGSFWKVARL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaggcggcaggatcagatcaccgtgattccctctctgaaggaggtatatgcg
gaccggtttgcaatcggtgcggcggtgagtccgcagacgatcgtaacgcagaaggagctg
ctggcggcgcactatggcagccttacggcggagaacgagatgaagccggtctccgtccag
cctgaggaaggacggttcacgttcgaagacgcggaccggatcgcccggtttgctgaggag
catgggatgcagatgcgcgggcatacgctcgtctggcacaaccagacgcccgattggatg
ttcgtggacggccagggacagccagccggcagggacctcgtgcttcagcggatgaaggac
catatcggtgccgtagtcggccgttataaggaccgcatcaaggtgtgggacgtcgtcaac
gaggcggtatcggacgaggggccgcagcttctgcgcccgtcgaagtggctggagacggcg
ggagaggaattcatccgcagggcgttcgagtatgcgcatgaggcggacccggatgcgctt
ctgttctacaacgattacaacgagtgccatccggacaaaagggaccgcatccaccggctg
ctgaagtccctgaaggagcagggaacaccggtccaaggcatgggcatgcagggccactgg
agcctgcagcggccgtccgcggacgagatccgggcggcggtggagctgtatgcctcgctg
gacctgcagctgcatatcacggagctcgacgtgtcggtattcgagtgggacgacaagcgg
acggacctgctggagccgacggccgagatgctggaagcccaggagcgcaggtacgaagag
atcttcggtctgctgcgggagtacagcggggtcatcacctccgtgacgttctggggagcc
gccgacgattatacgtggctcgatcattttccggtgaggagccgcaagaactggccgttc
ctcttcgataggaaccatcagccgaagggctccttttggaaggtggctcggctgtag

DBGET integrated database retrieval system