KEGG   Paenibacillus mucilaginosus K02: B2K_07045Help
Entry
B2K_07045         CDS       T02041                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B2K_07045
   00500 Starch and sucrose metabolism
    B2K_07045
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     B2K_07045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1589454..1590437)
Genome map
AA seq 327 aa AA seqDB search
MNPWKKLRFPLLAAALFAFVPGSPSPAEAATQPADAIVVDKNGTGAYKTVQAAINSIPDN
STTTRTIFIKNGTYNEKINIPSTKPNITLLGESTLGTILTYNDTASTAGSTTNSASTMVR
ANNFQARDITFRNTAGPTAGQAVALYVSGDRAVFKNIRATGYQDTLYATGTGRQYYYNSQ
IEGTVDFIFGSATAVFENCEIRSLGSGYVTAASTDQSKKYGYVFLNSRLTKNGAGNQTVY
LGRPWRPYSAVTYINTAMDSHIRPEGWHNWGNTANEATARYYEYGSTGAGANPTARVSWA
KTLTAGQANAITAKTVLAGSDGWDPTK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatggaaaaaactccgcttccctttactcgctgccgccctctttgcctttgtg
cccgggagtccatctcctgccgaggctgccacgcagcctgcggacgccatcgtcgtcgac
aagaacggaaccggcgcttataagacggtccaagccgccatcaactcgattcctgacaac
agcacgacgacccgtaccatcttcatcaagaacggcacctacaatgaaaagatcaacatc
ccctcgaccaagcccaacattaccctgctcggggaaagcacgctcgggaccatcctgacc
tacaacgacaccgcctccacggcgggcagcactacgaacagcgcgagcaccatggtgagg
gcgaacaacttccaggccagggacatcacgttccgcaatacggcagggcctactgcggga
caggcggtagctctctatgtatccggtgaccgggcggtcttcaagaacatcagagccacc
ggctatcaggataccctgtatgcgacgggaacgggacggcagtactactataacagccag
attgaaggcacggtcgattttattttcggctcggccacagcggtattcgagaattgcgaa
atccgcagcctcggctcaggctacgttacggccgcttcgacagaccaatcgaaaaaatac
gggtatgtctttctgaactcgaggctgaccaaaaacggggcgggcaatcaaaccgtgtat
ctcggcaggccttggagaccttactccgcagtaacctacatcaacacggcgatggactcc
cacatccgtcccgaaggctggcacaactggggcaatacggccaatgaagcgactgcccgc
tattatgaatacgggagcacgggagccggagccaacccgacggcgcgggtgagctgggcc
aagacgctgaccgccgggcaagcaaatgcgatcaccgcgaaaactgtgctggccgggtcg
gacggctgggatcctacgaagtaa

DBGET integrated database retrieval system