KEGG   Paenibacillus mucilaginosus K02: B2K_07050Help
Entry
B2K_07050         CDS       T02041                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2K_07050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_07050
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B2K_07050
Enzymes [BR:pmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B2K_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1590768..1592063
Genome map
AA seq 431 aa AA seqDB search
MHLQPRLHTAEEMGAIYLVYKEWKVFFMSRYSYFSHLQCPQCGLIFSGSEVRQLCPCGSP
LLARYDLEALRQVLPRPELEGRETSLWRYHELLPVERPENVVTLGEGMTPLLPLPRLGAA
YDLPHLYMKDEGIIPTGSFKARGAAVGLSKAKELGVRQFAMPTNGNAGAAWSLYAARAGI
RASVVMPVDAPLITRGECAASGADLYLVNGLISDAGRLVAGKIASGGIYDASTLKEPYRI
EGKKTMGIEIAEQFGWTLPDVILYPTGGGVGLIGIYKALSELLELGWIEGPLPRLVAVQA
AGCAPIVKAWQEGASRSEFWPNSGTAAFGINVPKALGDFLVLEAVYATGGCAVAVEDEAL
LSEQRLAASLEGAFVCPEGAAAFAAARKLRESGWIRDGERVVVLNTGMGIKYPETIPVNA
PVLQPEDALPS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgcatctgcagcccaggctgcacacagcggaagagatgggggctatttatttggtttat
aaagaatggaaggtgttcttcatgtcccgttacagttacttctctcatctgcagtgtccc
caatgcggactgatcttctctggctcggaagtgcggcagctgtgcccatgcggttctccg
ctgctcgcccgctacgatttggaggcgctgaggcaggttctgccccggcccgaactggag
ggaagagagaccagtctttggcgctaccatgaactgcttccggtagagcgtccggagaac
gtggtcacgcttggggaaggaatgaccccgctactccccctgcccaggctcggggcggcg
tatgacctcccccatctttatatgaaagacgaggggatcatccctaccggctcattcaag
gccaggggggcggccgtcggcctgtcgaaggcgaaggagctcggggtccggcagttcgcc
atgccgacgaacggcaatgccggggcggcctggtccctgtacgcggcccgcgcaggcatc
cgggcgtcggtcgtcatgccggtcgatgcgccgctgattacacggggcgaatgcgccgct
tccggagccgacctctatctcgtcaacgggctgatcagcgacgccggacggctcgtggcc
ggtaagatcgcctccggcggcatctatgatgcctctacccttaaggagccctaccgcatc
gaaggcaaaaagacgatgggcatcgagatcgccgagcagttcggctggactctgccggac
gtcattctctatccgaccggaggcggcgtcggtctcatcggcatctacaaagcgctcagc
gagctgctggagctcggctggatcgaagggccgctgccccggctggtggccgttcaggcg
gcaggctgcgcgcccatcgtgaaggcctggcaggaaggagcctcccgctcggagttctgg
ccgaactccggtacggccgccttcggcattaatgtgccgaaggcgctcggcgacttcctc
gtgctggaggccgtttacgccaccggcggctgcgctgtcgcagtggaagacgaagccctg
ctgagcgagcagcgtctggcggcatcgctggaaggcgcattcgtctgccctgaaggcgcg
gctgccttcgcagcggcccggaagctgcgcgagagcggatggattcgggacggggagcgg
gtggtcgtcctcaatacgggcatgggcatcaagtatccggagacgataccagtgaatgcc
cccgtacttcagccggaggatgcgctcccgtcatga

DBGET integrated database retrieval system