KEGG   Paenibacillus mucilaginosus K02: B2K_08885Help
Entry
B2K_08885         CDS       T02041                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B2K_08885
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_08885
   00620 Pyruvate metabolism
    B2K_08885
   00650 Butanoate metabolism
    B2K_08885
  Lipid metabolism
   00071 Fatty acid degradation
    B2K_08885
  Amino acid metabolism
   00350 Tyrosine metabolism
    B2K_08885
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B2K_08885
   00626 Naphthalene degradation
    B2K_08885
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B2K_08885
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B2K_08885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1991683..1994295
Genome map
AA seq 870 aa AA seqDB search
MAIREKQEEQAKPAAEQEVGRLVAKAVKAQQAFMRLDQAQVDAIVQAMALAGLEQHMKLA
KMAVEETGRGVYEDKITKNLFATEYIYHSIKYDKTVGVIEENPYENYRKVAEPVGVIAGV
TPVTNPTSTTMFKSLIAMKTRNPIIFAFHPSAQKCSAAAARVVMEAAVKAGAPEGCIQWI
EHPSVEATGLLMNHPDVALVLATGGSSMVKAAYSTGKPALGVGPGNVPCFIEKSADLKQA
VTDLILSKTFDNGMICASEQAVIIEEDVYAEVRRLMIGFGCYFLNGEETEAVSKLVINSD
KCAVNAVIVGQPAVKIAQMAGINVPADTKILVAELQGVGPAYPLSAEKLSPVLACYKVKN
AAQGIQRAAEVTAFGGMGHSSVIHSKNDAVIADFAAALKTGRVIVNSPSTHGAIGDIYNT
NLPSLTLGCGSYGHNSTTSNVTAVNLINVKRVAYRTVNMQWFKIPPKVYFEKGATQYLEK
MPDISRILIVTDPMMVQLGYVERVEHYLRKRQTPVAVEVFSDVEPDPSVDTVERGTDLME
RFQPDCIIALGGGSPMDAAKAMWLFYEYPETSFQSLKQKFMDIRKRVYKYPRLGRKAKFV
AIPTTSGTGSEVTSFAVITDKKQGQTKYPLADYELTPDVAIIDPDYVYSLPKTAVADTGM
DVLTHAIEAYVSVMANDYTDGLAMKAIQLVFQNLEKSYATADPVAREKMHNASTIAGMAF
ANAFLGINHSLAHKWGGEFHTAHGRTNAILMPHVIRYNASKPSKFASFPKYDHFVADERY
AEIARMLGLPARTTEEGVNSLVDAVRGLGQAVGIPASFSELGIDPQVFESRVEELADRAF
EDQCTTANPRMPLVSELAEVYRKAFYGRFE
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcgattagagagaaacaggaagaacaggcaaagccggcggcggaacaggaagtagga
aggcttgtcgccaaagcggtcaaggcgcagcaggcattcatgcggctcgaccaggcgcag
gtggacgcaatcgtgcaggcgatggccctcgcggggctcgagcagcacatgaagctcgcg
aagatggctgttgaagagaccggacgcggcgtctacgaagacaagatcacgaagaatctg
ttcgcgaccgagtacatctaccacagcatcaagtatgacaaaacggtgggcgtcattgag
gagaatccttacgagaactaccgcaaagtagccgagccggtaggcgtgatcgccggggta
acgccggtcacgaacccgacctccaccacgatgttcaaatctctgatcgccatgaagacc
cgcaatcccatcatctttgcatttcacccgtccgcacagaaatgcagtgcggctgccgcc
cgcgtcgtcatggaagcagccgtgaaggcgggcgcaccggaaggctgcatccagtggatc
gagcatccttccgtcgaagctaccgggctgctcatgaaccatccggatgtggcgctggtt
ctggctaccggcggctcctcgatggtcaaagcggcttacagcacagggaagccggcgctc
ggcgtaggccccggcaacgtgccgtgcttcatcgagaagagcgccgatctcaagcaggcc
gtcacggacctgatcctctccaagacgttcgacaacggtatgatctgcgcctccgagcag
gcggtcattatagaagaggacgtttacgccgaagtgcgccgccttatgatcgggttcggc
tgctacttcctgaacggcgaagagaccgaggcggtatcgaagctcgtcatcaacagcgac
aagtgtgcggtgaacgccgtgatcgtcggccagccggccgtgaagatcgcgcagatggcc
ggcatcaacgttccggccgacacgaagatcctggtcgccgagctgcaaggtgtaggtccg
gcttacccgctctccgcggagaagctcagccccgtgctggcgtgctacaaggtgaagaac
gccgcccagggaatccagcgggccgcggaagtgaccgccttcggcgggatgggccactcc
tccgtcatccattcgaagaatgatgcggtgatcgccgactttgccgctgcgctgaagacg
ggccgcgtcatcgtgaattcgccgtccacccacggggcgattggcgacatctataacacg
aacctgccgtccctgacactcggctgcggctcctacggccataactcgacgacctccaac
gtcacggcggtcaacctgatcaacgtgaagcgggtcgcctaccgcaccgtcaatatgcag
tggttcaagattccgccgaaggtctacttcgagaagggcgcgacccagtacctggagaaa
atgcccgacatctcgcggatcctgatcgtcaccgacccgatgatggtgcagctcggctac
gtggagcgcgtggagcattacctgcgcaagcgccagacgccggtggctgtggaagtattc
agcgacgtcgagccggatccgtcggtggatacggtcgagcgcggcacggatctcatggaa
cgcttccagccggactgcatcatcgccctcggcgggggctccccgatggacgcggcgaag
gccatgtggctcttctacgaatatccggagacgagcttccagtccttgaagcagaaattc
atggatatccgcaagcgggtgtacaaatatccgcggctcggccgcaaggcgaagttcgtg
gcgattccgacgacgtcgggtacgggctcggaggtcacctccttcgcggtcatcaccgac
aagaagcagggacagacgaaatacccgctggccgactacgagctcacgccggatgtggcg
atcatcgatccggactatgtgtactccctgccgaagacggccgtcgctgatacggggatg
gacgtattgacccacgcgattgaggcgtacgtctcggtgatggcgaacgactatacggac
ggcctggcgatgaaggcgatccagctcgtgttccagaacctggagaagtcctatgcaacg
gcagatccggtggcccgggaaaaaatgcacaacgcctcgacgatcgccgggatggctttt
gccaacgcgttcctcgggatcaaccactccctggcgcacaagtggggcggcgagttccac
acggcgcacggccgcaccaatgcgatcctgatgccgcacgtcatccgctataatgccagc
aagccgtcgaagttcgcctccttcccgaaatacgaccacttcgtcgccgatgagcggtac
gccgagatcgcccgcatgctggggctgccggcccgcacgacggaagaaggggtgaacagc
ctcgttgacgcggtccgggggctcggccaggcagtgggcattccggcttcgttctcggag
ctgggcatcgacccgcaggtgttcgagagccgggtggaggagctcgccgaccgtgccttc
gaagaccagtgcacgacagccaatccgcggatgccgctggtaagcgagctggcggaggta
taccgcaaggcgttctacggccggttcgaatag

DBGET integrated database retrieval system