KEGG   Paenibacillus mucilaginosus K02: B2K_09650Help
Entry
B2K_09650         CDS       T02041                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2K_09650
   01230 Biosynthesis of amino acids
    B2K_09650
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_09650
   00030 Pentose phosphate pathway
    B2K_09650
   00051 Fructose and mannose metabolism
    B2K_09650
   00052 Galactose metabolism
    B2K_09650
  Energy metabolism
   00680 Methane metabolism
    B2K_09650
Enzymes [BR:pmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B2K_09650
Protein phosphatases and associated proteins [BR:pmw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B2K_09650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2160532..2161497
Genome map
AA seq 321 aa AA seqDB search
MSVKKIAVLTSGGDSQGMNAAVRAVVRSGLFHGLEVFAVQRGYAGLINDDIRPMDLRSVG
DIIQRGGTVLQTARCKEFLTPEGQQLGADNLRKHGIDGLVVIGGDGSYQGANKLSKLGIK
TMGLPGTIDNDIPFTDFTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIAL
YAGLASGAETIIVPEVGYDMDEISNRMAENFAQGKRHSIIIVAEGVCGGDEIAAEITKRN
GIEPRVTVLGHIQRGGAPTHNDRILASSLGDFAVRKLIEGDSGKACGIIKGELTVTDIDK
VVNTKKPFNMELYELAKRLSQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaagattgcagtactcaccagcggcggcgattcccaggggatgaacgca
gccgtccgcgccgttgtgcgcagcggcctgttccacggcctcgaagtgttcgccgtccag
cgcggttacgcgggcctgatcaacgatgacatccgtccgatggacctgcgcagcgtcggc
gatattatccagcgcggcggcacggtgctccagacggctcgctgtaaggagttcctgacg
ccggaaggacagcagctcggcgcggacaacctgcgcaagcacggcatcgacggactcgtc
gtgatcggcggggacggctcgtaccagggcgcgaacaagctcagcaagctcggcatcaag
acgatgggcctgccgggcaccatcgacaacgacatcccgttcacggacttcacgatcggc
ttcgatacggcggtctccatcgtggtcgatgcgatcaacaagctgcgtgatacgatgagc
tcgcatgagcgttcgtccatcgtggaagtcatgggccgccactgcggcgacatcgccctg
tatgcgggccttgcgagcggtgcggagacgatcatcgtgccggaagtcggctacgatatg
gacgagatctcgaaccggatggcagagaacttcgcccagggcaagcgccacagtatcatc
atcgtggcggaaggggtctgcggcggcgacgagatcgcggcggagatcaccaagcgcaac
ggcatcgagccgcgcgtaaccgtgctcggccatattcagcgcggcggtgcgccgacgcat
aatgaccggatcctcgcgagcagcctcggcgacttcgccgtgcgcaagctgatcgagggc
gactcgggcaaggcctgcggcatcatcaagggcgagctgaccgtgaccgacatcgacaag
gtcgtcaacacgaagaagccgttcaacatggagctgtacgagctcgcgaagcgtctgtcc
caataa

DBGET integrated database retrieval system