KEGG   Paenibacillus mucilaginosus K02: B2K_12775Help
Entry
B2K_12775         CDS       T02041                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pmw00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2978531..2980591)
Genome map
AA seq 686 aa AA seqDB search
MEKSIPLDALQLGVCYYPEQWPETLWEDDFQRMKAMNISYVRVAEFAWTIFEPEEGVFEF
GLFDRVLDLAHQYGLKIIMGTPTATPPAWLTHKYPEVLNASKEGIAYRHGMRRHYNYSSS
KYRELCARITREMALHYKDHPAVVGWQIDNELNCEISVFYSEADHAAFRAWVKEKYGTLE
ALNRAWGTVFWSQTYTDWEQIHLPQPTTSDSPNPHLVLDEKRFISQNTIAFAQVQADILR
EVVPHHWVTTNGKFGHLDNHALTDSLLDFFSYDSYPQFSTIIPTDEDEPLLDRKWSQNLS
AVRDISPNFCIMEQQAGPGGWVNRMDMPSPQPGQMRLWTYQSVLHGADLVVYFRWRTAAF
GTEIYWHGLNDYHNRPNRRVREAAEVGREFAAIGASLAGSQYTAHAAILRDYDNEWDGEF
DVWHGPLTEKSTNAWYKQLQYHHIPADIVYLRDAVNLEQLQRYKVLVYPHAAIMTDETAR
LLTEYAEAGGIVIFGARTGYKTPDGHCRMQPFPGPVAGLCGITVSDFTRIKGTVPAPALR
WKEEKFAAAAAAEAFNDILQVEDADVEVMAEYASSYYAGEPALTRRRVGRGEAWYYGAAF
NEAVVGALIGHLELRSPVGDWLEAPRQVEIGIREGARGRYVFLLNYGDQPADLVLHEPRQ
DLLTGKRISGAVQMPAYGVMLLEWTS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaatccattccattggacgccctgcagctgggcgtctgctactatcctgaacaa
tggcccgagacgctctgggaagacgactttcagcgcatgaaggccatgaacatctcttac
gtccgggtagcggagtttgcgtggacgatcttcgaaccggaggaaggcgtcttcgaattc
ggactctttgaccgggtgcttgatctggcgcatcaatacggcttgaagatcatcatgggc
acgccgaccgccacgccgccggcctggttaacgcacaagtaccccgaagtgctgaacgca
tccaaggaagggatcgcctaccgtcacgggatgcgccgccactataactacagcagctcc
aaatacagagagctctgtgcccgaatcacacgcgagatggctctgcattataaagatcac
cccgctgtcgtcggctggcagatcgacaatgagctgaactgtgagatcagcgtgttctac
tcggaggccgatcatgcggcgtttcgggcttgggtcaaagaaaaatacggcaccctggaa
gcgcttaatagagcctggggaactgtcttctggagccagacctatacggactgggagcag
attcacctgccgcagcccacgacctccgattcaccgaaccctcatctggtgctcgacgag
aagcggttcatttcgcagaacacaatcgcgttcgctcaggttcaggcggacattctccgc
gaggtggtgcctcatcattgggtaacgaccaacggcaagttcggtcatctggataaccac
gccctgaccgattcgctgctcgactttttctcgtacgattcctacccgcagttctcgacg
atcatccccaccgatgaagatgagccgctgctggaccggaagtggagccagaatctcagc
gccgtccgcgatatatcgccgaacttctgcatcatggagcagcaggcgggtcccggcggc
tgggtcaaccggatggacatgccttccccgcagcccggacagatgcggctgtggacgtac
caatcggtgctgcacggggccgatttggttgtctatttccgctggcggacggctgccttc
ggcaccgaaatctactggcacggcctgaacgattaccataaccggccgaaccgccgggtc
cgggaagcggccgaggtaggacgtgaatttgccgccatcggcgcaagcctggccggaagc
caatataccgcccacgcggccatactccgggactatgataacgaatgggacggagagttc
gatgtctggcatggtcccctgacggagaagagcacgaacgcctggtacaagcagctgcag
taccatcatatcccggccgacatcgtgtacctccgtgacgcggtgaacctggaacagctg
cagcgctacaaggtgctggtatatccgcatgccgcgatcatgaccgacgagacggccagg
ctgctgacggagtacgccgaagcgggcgggatcgtcatcttcggtgcgaggacgggatac
aagacgccggacggccactgccggatgcagccgttcccgggaccggtcgcgggcttgtgc
ggaatcaccgtgtcggatttcacgcggatcaaaggaacggtgccggcccctgcgctgcgc
tggaaggaagagaagtttgccgctgctgctgcggcggaagcgttcaatgacattctgcag
gtggaagacgcggatgtggaagtgatggcggagtatgcgtccagctactatgcgggagaa
ccggccctgactaggcgcagggtcggccgtggagaagcctggtattacggggcggccttc
aatgaagcggtagtcggtgcgctgatcggacatctggagctccggtccccggtcggagat
tggctggaagcgccccggcaggtcgaaatcggcatccgcgagggagcccgaggccgctat
gtattcctgctgaactacggggatcagccggctgaccttgtgctgcacgagcctcggcag
gacctgctcactggtaagcggatcagcggagccgtgcaaatgccggcgtatggggtcatg
ctgctggaatggacatcgtaa

DBGET integrated database retrieval system