KEGG   Paenibacillus mucilaginosus K02: B2K_14180Help
Entry
B2K_14180         CDS       T02041                                 

Definition
aryl-phospho-beta-D-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_14180
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     B2K_14180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3279038..3280480
Genome map
AA seq 480 aa AA seqDB search
MIHTQVRPFPQDFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIEGTTYKGSNGDVAMDH
YHRYREDIALMAEMGLKAYRFSVSWPRIYPSGHGEENEAGLQFYDNLIDELLAHGIEPVL
TLYHWDVPQALMDEYGAWESRRIIEDFDNYCITLFKRYGDRVKYWVSLNEQNYNTNHGFI
TAMHPPGVKDRKRFYQANHHAFLANAKVIDSFRHYVPHGKIGPSFAYSPAYPASSKPEDL
LAFENAEEFTNYWWLDVYCLGQYPQIPLRYLEEQGLAPVFEEGDLELLRRGRPDFVGVNY
YQTITYEKNPLDGVAEGRMNTTGQKGSNQSTGMPGLFKTAANPNLETSNWDWAIDPIGLR
IGMRRITSRYGLPVFITENGLGEFDKLEADDTVHDDYRIAYLRSHLLQCQQAISDGVELI
GYCSWSFTDVLSWLNGYQKRYGFVYIDRDETDARSLRRIKKLSFHWYREVIRTGGEHLLK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgattcatacgcaggtacgtccgtttccgcaggattttctctggggctccgcttcggcg
gcctatcagatcgaaggggcctggaatgaggacgggaagggcccgtcggtgtgggatgtg
tttaccaaaatcgaggggacaacgtataaaggaagcaacggcgacgtggccatggaccat
taccaccgctaccgggaggatatcgcccttatggcggagatggggctgaaagcttaccgc
ttctcggtcagctggccgcggatctatccgtccggccatggcgaggagaacgaagcgggc
ctgcagttctacgacaacctgatcgacgagctgctcgcgcacggcattgagccggtgctt
acgctgtaccactgggatgtcccccaggcgctgatggacgaatatggggcgtgggagtcc
cggcggattatcgaggattttgacaactactgcattaccctgttcaagcgttacggggac
cgggtgaaatactgggtctcgctcaacgagcagaattacaacacgaatcacggctttatt
accgccatgcatccgcctggagtcaaagaccgcaaacgcttctatcaggccaaccatcat
gccttcctggccaatgccaaggtcatcgactccttccgccactacgtgccgcatggtaaa
attggtccaagcttcgcgtattctccggcctatccggcttcgagcaagcctgaggatctg
ctggccttcgagaatgcggaggaattcaccaactactggtggctggatgtctactgcctc
gggcaatatccccagatcccgctgcggtatctcgaagagcaggggctggctcccgtcttc
gaggagggagacctcgagctgctgcgccggggcagaccggacttcgtcggcgtcaactac
tatcagacgattacgtatgagaagaatccgctggacggcgtggccgaaggccggatgaat
acgaccggccagaagggcagcaaccagtcgaccgggatgccggggctgttcaagacggcg
gcgaatccgaatctcgagacctcgaattgggactgggccatcgacccgatcggcctgcgg
atcggcatgcgccgaatcacgagccgctacggcctcccggtcttcatcacggagaacggc
ctcggcgaattcgataagctggaagcggatgacacggtccatgacgattaccggatcgcc
tacctgagaagccatctgcttcaatgccagcaggcgatcagcgacggggtggagctcatc
ggctactgctcctggtcgttcaccgatgtgctcagctggctcaacgggtatcagaagcgc
tatggatttgtctatatcgaccgggatgagaccgatgccaggtcgctgcgccggatcaag
aagctcagcttccactggtaccgggaagtcatccgaacaggcggggagcatttgctgaag
taa

DBGET integrated database retrieval system