KEGG   Paenibacillus mucilaginosus K02: B2K_15390Help
Entry
B2K_15390         CDS       T02041                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2K_15390
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B2K_15390
Enzymes [BR:pmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     B2K_15390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3511454..3512266
Genome map
AA seq 270 aa AA seqDB search
MFLDRIVTTKHEEVAQLQARTTIAEMEKIIAALPPTLGFERALGAGRQRSMGLIAEVKKA
SPSKGLIREDFEPVSLARAYEQAGADCISVLTDVQYFQGANEYLTRVREAVNVPLLRKDF
TIDPYQIYEARCIGADAILLIAAILTTEQMREYQQTARSIGLDVLIEVHDKEELDRVLEL
SPTMVGINNRNLRTFVTDLHTTEELIQYIPKDVTVVSESGISRSEEITYLESIGARAVLV
GEHFMRQESVGGAVDDLLGVRPEASASREL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgatcgaatcgtaacgacgaaacacgaggaagtcgcccagctccaagcgcgg
acgacgatcgccgagatggagaagatcattgcggcgctgccgccgacgcttggctttgag
cgggccctcggggcaggccgccagcgcagcatggggctcatcgccgaggtgaagaaggcc
tcgccttccaaaggcctcatccgggaagacttcgagcccgtgtcactggcccgagcttat
gaacaggccggagccgactgcatctcggtgctgaccgacgtgcagtattttcagggggcg
aacgagtacctcacgcgtgtaagggaggcggtgaacgttccgctgctgcgcaaggatttc
accatcgacccgtaccagatctatgaagcccgctgtatcggtgcggatgcgatcctgctg
attgcggcgatcctgacgacggagcagatgcgcgaatatcagcagacggcgcgcagcatc
gggcttgacgtgctgatcgaagtgcatgacaaggaagagctggaccgcgtgctggagctg
tccccgacgatggtgggcatcaacaaccggaatctgcgcactttcgtgacagatcttcat
acgaccgaagaactcattcaatatatacctaaagacgtaacggtagtcagcgagagcggc
atctcccgcagcgaagagattacatacctggagtcgatcggcgccagggccgtgcttgtc
ggcgagcacttcatgaggcaggagagcgtaggcggggcggtcgacgacctgctgggagtc
cggccggaagcttcggcttccagggagctgtaa

DBGET integrated database retrieval system