KEGG   Paenibacillus mucilaginosus K02: B2K_15400Help
Entry
B2K_15400         CDS       T02041                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2K_15400
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_15400
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B2K_15400
Enzymes [BR:pmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B2K_15400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3512948..3514147
Genome map
AA seq 399 aa AA seqDB search
MFNGPDEFGRFGKFGGRYVPETLMNALIELEDAFKTISKTDKFQEELTYWLHRYSGRPTS
LYYAGRLTEHLGGAKVYLKREDLNHTGAHKINNALGQGLLAKYMGKTKIIAETGAGQHGV
ATATVAALLGFECKVFMGEEDMKRQQLNVFRMNLLGTEVVPVTSGTRTLKDACNETLRYW
VSHVEDTFYILGSATGPHPYPLMVRDFQRIIGDEARCQILEQEGRLPDTVIAAVGGGSNA
IGMFYPFIGDEAVKLVGVEAAGHGINTEKHAATMTMGSKGVFQGSYSYLLQDEHGQVQEA
HSISAGLDYPGIGPEHSHLMDTGRAQYVPITDHEAMEALKLLCRTEGIIPALESAHAIAE
TIKRAPQMGKDQIIVVSLSGRGDKDVHTIMSHMEGAVAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacggaccggatgagttcgggcgcttcggcaagttcggcgggcgctatgttccc
gaaacgctgatgaacgcactgatcgagctggaggatgcattcaaaacgatctccaaaact
gacaagtttcaggaggagctgacctactggcttcaccgctattccggtcgtccgacctcc
ctgtattatgcagggcgtctcaccgaacacctgggcggcgccaaggtgtatttgaagcgc
gaggatttgaatcatacgggtgcgcacaaaatcaacaacgcgctcggacagggccttctg
gccaaatatatgggcaagacgaagatcatcgccgagacgggagccggccagcacggtgta
gcgaccgcaacggtggcggcgctgctcggcttcgagtgcaaggtgttcatgggcgaggaa
gacatgaagcgccagcagctgaacgtcttccgcatgaacctgctcggcaccgaggtggtg
ccggtgacctccggtacccggacgctgaaggatgcctgcaacgagacgctccgctactgg
gtatcccacgtagaggatacgttctatattctcggttcggcgacgggaccgcacccttat
ccgctgatggtccgcgacttccagcgcattatcggcgatgaggcgcgctgccagattctc
gagcaggaaggccgtctgccggatacggtgattgccgcagttggcggcggcagcaatgcg
atcgggatgttctatccgttcatcggcgatgaggccgtgaagctggtcggggtggaagcg
gcaggacacggaattaacaccgagaagcatgcggccacaatgacgatgggcagcaagggc
gtgttccagggctcctacagctacctgctgcaggatgagcacggacaggtgcaggaggcc
cactcgatctccgcaggactggattatccgggcatcggaccggagcactcccatttgatg
gataccggccgtgcccagtatgtgccgattacggatcatgaagcgatggaagcgctgaag
ctgctgtgccggacagaaggcatcatcccggctctcgaaagcgctcatgcgatcgccgag
acgatcaaacgcgctccgcagatgggcaaggaccagatcatcgtcgtcagcctgtcgggc
cgcggggacaaagacgtgcatacgatcatgagccatatggaaggagctgtagcgaaatga

DBGET integrated database retrieval system