KEGG   Paenibacillus mucilaginosus K02: B2K_15400Help
Entry
B2K_15400         CDS       T02041                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2K_15400
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_15400
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B2K_15400
Enzymes [BR:pmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B2K_15400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3512948..3514147
Genome map
AA seq 399 aa AA seqDB search
MFNGPDEFGRFGKFGGRYVPETLMNALIELEDAFKTISKTDKFQEELTYWLHRYSGRPTS
LYYAGRLTEHLGGAKVYLKREDLNHTGAHKINNALGQGLLAKYMGKTKIIAETGAGQHGV
ATATVAALLGFECKVFMGEEDMKRQQLNVFRMNLLGTEVVPVTSGTRTLKDACNETLRYW
VSHVEDTFYILGSATGPHPYPLMVRDFQRIIGDEARCQILEQEGRLPDTVIAAVGGGSNA
IGMFYPFIGDEAVKLVGVEAAGHGINTEKHAATMTMGSKGVFQGSYSYLLQDEHGQVQEA
HSISAGLDYPGIGPEHSHLMDTGRAQYVPITDHEAMEALKLLCRTEGIIPALESAHAIAE
TIKRAPQMGKDQIIVVSLSGRGDKDVHTIMSHMEGAVAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacggaccggatgagttcgggcgcttcggcaagttcggcgggcgctatgttccc
gaaacgctgatgaacgcactgatcgagctggaggatgcattcaaaacgatctccaaaact
gacaagtttcaggaggagctgacctactggcttcaccgctattccggtcgtccgacctcc
ctgtattatgcagggcgtctcaccgaacacctgggcggcgccaaggtgtatttgaagcgc
gaggatttgaatcatacgggtgcgcacaaaatcaacaacgcgctcggacagggccttctg
gccaaatatatgggcaagacgaagatcatcgccgagacgggagccggccagcacggtgta
gcgaccgcaacggtggcggcgctgctcggcttcgagtgcaaggtgttcatgggcgaggaa
gacatgaagcgccagcagctgaacgtcttccgcatgaacctgctcggcaccgaggtggtg
ccggtgacctccggtacccggacgctgaaggatgcctgcaacgagacgctccgctactgg
gtatcccacgtagaggatacgttctatattctcggttcggcgacgggaccgcacccttat
ccgctgatggtccgcgacttccagcgcattatcggcgatgaggcgcgctgccagattctc
gagcaggaaggccgtctgccggatacggtgattgccgcagttggcggcggcagcaatgcg
atcgggatgttctatccgttcatcggcgatgaggccgtgaagctggtcggggtggaagcg
gcaggacacggaattaacaccgagaagcatgcggccacaatgacgatgggcagcaagggc
gtgttccagggctcctacagctacctgctgcaggatgagcacggacaggtgcaggaggcc
cactcgatctccgcaggactggattatccgggcatcggaccggagcactcccatttgatg
gataccggccgtgcccagtatgtgccgattacggatcatgaagcgatggaagcgctgaag
ctgctgtgccggacagaaggcatcatcccggctctcgaaagcgctcatgcgatcgccgag
acgatcaaacgcgctccgcagatgggcaaggaccagatcatcgtcgtcagcctgtcgggc
cgcggggacaaagacgtgcatacgatcatgagccatatggaaggagctgtagcgaaatga

DBGET integrated database retrieval system