KEGG   Paenibacillus mucilaginosus K02: B2K_15685Help
Entry
B2K_15685         CDS       T02041                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2K_15685
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_15685
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B2K_15685
Enzymes [BR:pmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B2K_15685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3575570..3576964
Genome map
AA seq 464 aa AA seqDB search
MNFISTRGKTAGIGFIDTVLMGLADDGGLLIPNEIPHISAARLKEMESLSYQDLAYEVFS
YYTNNEIPDEDLKDLIRQSYATFRDPEVTPVKKLTDNMYVMELFHGPTFAFKDVALQFLG
NLYAYVSKKQNEIIHILGATSGDTGASAIEGVRGKEGIRICILHPHQKVSRVQELQMTTV
DDENVLNLSVEGTFDDCQRIIKDLFADVPFKTKYHLRAINSINFVRILAQTVYYFYAYFR
VQKDKPGAKVNFSVPTGNFGDIFAGYLAKRMGLPVNKLILATNENNILERFVLEGVYRPG
EFKSTHSPSMDIQVASNFERYLYYLLGENPQQAAAYMEGFKTDGVITIAPELLSRVQADF
AAHGVGGEECLATIGSYYREHGYLLDPHTACGVAAYEKCSPAEEVCVTLSTAHPAKFNES
IELVGIEQTYPQPIQDLFAKPQHQEIVDSSVEEIVRRLESFYTK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattagcactaggggcaaaacagcaggaatcggatttatcgatacggtattg
atgggtctcgccgatgacggcggcctgctcattccaaacgaaattccgcacatctcggca
gccaggctgaaagaaatggagagcctcagctaccaggatctggcttatgaggtgttctcg
tattatacgaataacgaaattcccgatgaagatctgaaggatctgatccggcagagctat
gcgaccttccgtgatccggaagtgacgccggtgaagaaactcacggacaatatgtacgta
atggagctcttccacgggcctaccttcgcgttcaaggacgtggccctgcagttcctaggc
aacctgtacgcgtacgtgtcgaagaagcagaacgagatcattcacatcctgggggctact
tccggtgataccggcgcttcggccatcgaaggcgtccggggcaaggaaggcatccgcatc
tgcattcttcacccgcatcagaaggtcagccgggtgcaggagctgcaaatgacgaccgtt
gacgacgagaacgtgctgaacctctcggtggaaggcaccttcgacgactgccagcgcatc
atcaaggatctgttcgccgacgtgccgttcaagacgaaataccacctgcgcgcgatcaac
tcgatcaactttgtgcgcatcctggcccagactgtgtactacttctacgcttacttccgc
gtgcagaaggataagccgggcgcgaaggtgaacttcagcgtgccgacaggcaacttcggc
gacatcttcgcgggctatctcgcgaagcggatgggcctgccggtgaacaagctgatcctc
gcgacaaacgagaacaacatcctggagcgcttcgtcctcgaaggcgtataccgtccgggc
gagttcaagagcacgcacagcccatcgatggacattcaggtggcgagcaacttcgagcgg
tacctgtactatctgctcggggagaacccgcagcaggctgccgcctacatggaaggcttc
aagacggacggcgtgattacgatcgctcccgagctgctcagccgggtgcaggcggacttt
gctgcccacggcgtgggcggcgaggagtgcctggcgaccatcggcagctactaccgcgag
cacgggtacctgctggatccgcacacggcgtgcggtgtggcggcttatgagaagtgcagc
ccggcggaggaagtgtgcgtaaccttgtcaacggcccacccggcgaagttcaacgagtcc
atcgagctcgtgggcatcgagcagacgtacccgcagccgatccaggacctgttcgcgaag
ccgcagcaccaggagatcgtcgattcctcggtggaggagattgtccgccgcctggagagc
ttctatacgaaataa

DBGET integrated database retrieval system