KEGG   Paenibacillus mucilaginosus K02: B2K_17570Help
Entry
B2K_17570         CDS       T02041                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2K_17570
   01230 Biosynthesis of amino acids
    B2K_17570
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_17570
  Energy metabolism
   00680 Methane metabolism
    B2K_17570
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_17570
Enzymes [BR:pmw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     B2K_17570
Exosome [BR:pmw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   B2K_17570
  Exosomal proteins of melanoma cells
   B2K_17570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3975164..3975706
Genome map
AA seq 180 aa AA seqDB search
MKTIYVVRHGQAEGQEPGAKLTENGVQQAARLVSFFGGRQVDCILSSPFERAYSTILPLA
RQRGIQIQTDERLAERVLSGGSHPEWREMLRRTYDDLDLCWEGGESGRAAMKRAAAVVEE
VLNSHYTSAVLVSHGNLISLLLKLYDERIGFAEWERLTNPDVYQFSFRDELPEIQRIWNP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatctatgtggttcggcacggccaggccgaagggcaggagcccggagccaag
ctgacggagaacggtgtgcagcaggcggccaggctggtttcattttttggcggcaggcaa
gtggattgcattctctccagtcccttcgaaagggcttactcgaccatcctgccgctagcc
cgtcagcggggaatccagattcagacggatgagcggttagcggagagggtcttgtccggc
gggagccatccggagtggcgggagatgcttcgcaggacatacgatgatttggacttgtgc
tgggagggcggggaatccggcagggcggctatgaagcgtgccgcggctgtggtggaggaa
gtgctgaacagtcattacacgagtgctgtcctcgtatcgcatgggaacctgatctcgctt
ctgctgaagctttatgatgaacgcatcgggttcgcggagtgggaacggttaaccaatccg
gatgtgtatcaattctccttccgggacgagcttcccgagattcagcgaatatggaacccg
taa

DBGET integrated database retrieval system