KEGG   Paenibacillus mucilaginosus K02: B2K_17880Help
Entry
B2K_17880         CDS       T02041                                 

Definition
(GenBank) uricase
  KO
K16838  
urate oxidase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:1.7.3.3 4.1.1.97]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B2K_17880
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    B2K_17880
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     B2K_17880
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     B2K_17880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4035153..4036187
Genome map
AA seq 344 aa AA seqDB search
MSRTETGKRTMYYGKGDVLVYRTFAEPLTEVTRIPESPFTGDGNVIMAMNVKVAVRGEAF
LTSFTEGDNSMVVATDSMKNLIIRHAADYEGSTVEGFLYHIAGIFLKKYSHITTMELEAD
RLPFDGLSVASPDGGWRESGLVFRRSHNDHTSASVVVERAEGGVLTVRKQESLLTGLQLI
KVKGSSFAGFIRDEYTTLPETQDRPLFIWLNIGWTYKDEKDAIDPKNGSYAASEQIRDIA
HTVFHEANSPSIQHLIYRIGLRILERFPQLAEVRFESNNRTWETVVESVDGSDARVYTEP
RPPYGFQGFSMTQEDLAAAAGGEDGEAAAALETAASERSEAPTS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacggaaacgggcaaacgcacgatgtactatggaaaaggggatgtgctcgtc
taccgcacgttcgccgagccgctgaccgaggttacacgcattccggagtcgccgttcacg
ggggacggcaatgtcattatggcaatgaatgtcaaggtggcggtccggggggaggcgttc
ctgacctcgttcaccgaaggggacaattcgatggtcgtggccaccgattcgatgaaaaat
ctgatcatccgccacgccgccgactacgagggcagcaccgtcgaaggattcctgtaccac
atcgcgggcatcttcctgaagaagtattcgcatatcaccactatggaactggaagcggac
cgcctgcccttcgacggcctgagcgtggcttcgcccgacggaggctggagggagagcggc
ctcgtcttccgccggtcgcacaacgaccatacgtcggcttccgttgttgtggagcgtgcg
gagggcggggtcctcacggtgcggaagcaggagagcctgctgacgggcctgcagctcatc
aaggtcaaaggcagctccttcgccggcttcatccgcgacgagtacacgaccctgccggag
acgcaggaccgtccgctctttatctggctgaacatcggatggacgtataaggacgagaag
gatgcgatcgatccgaagaacggaagctacgccgcatcggagcagatccgggatattgcg
cacacggtgttccatgaagcgaactccccgtcgattcagcatttgatctaccggatcggg
ctgcgcatcctggagcggttcccgcagctggccgaggtacgcttcgagtcgaacaaccgg
acttgggagacggtggttgagagtgtggacggctcggacgcaagagtctatacggagccg
cgcccgccgtacggcttccagggcttctcgatgacgcaggaggacctggccgccgccgca
ggcggagaggacggcgaggcggcagcggcgctcgagaccgcagcatcggagcgttcggag
gctcccacctcatga

DBGET integrated database retrieval system