KEGG   Paenibacillus mucilaginosus K02: B2K_17880Help
Entry
B2K_17880         CDS       T02041                                 

Definition
uricase
Organism
pmw  Paenibacillus mucilaginosus K02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4035153..4036187
Genome map
AA seq 344 aa AA seqDB search
MSRTETGKRTMYYGKGDVLVYRTFAEPLTEVTRIPESPFTGDGNVIMAMNVKVAVRGEAF
LTSFTEGDNSMVVATDSMKNLIIRHAADYEGSTVEGFLYHIAGIFLKKYSHITTMELEAD
RLPFDGLSVASPDGGWRESGLVFRRSHNDHTSASVVVERAEGGVLTVRKQESLLTGLQLI
KVKGSSFAGFIRDEYTTLPETQDRPLFIWLNIGWTYKDEKDAIDPKNGSYAASEQIRDIA
HTVFHEANSPSIQHLIYRIGLRILERFPQLAEVRFESNNRTWETVVESVDGSDARVYTEP
RPPYGFQGFSMTQEDLAAAAGGEDGEAAAALETAASERSEAPTS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacggaaacgggcaaacgcacgatgtactatggaaaaggggatgtgctcgtc
taccgcacgttcgccgagccgctgaccgaggttacacgcattccggagtcgccgttcacg
ggggacggcaatgtcattatggcaatgaatgtcaaggtggcggtccggggggaggcgttc
ctgacctcgttcaccgaaggggacaattcgatggtcgtggccaccgattcgatgaaaaat
ctgatcatccgccacgccgccgactacgagggcagcaccgtcgaaggattcctgtaccac
atcgcgggcatcttcctgaagaagtattcgcatatcaccactatggaactggaagcggac
cgcctgcccttcgacggcctgagcgtggcttcgcccgacggaggctggagggagagcggc
ctcgtcttccgccggtcgcacaacgaccatacgtcggcttccgttgttgtggagcgtgcg
gagggcggggtcctcacggtgcggaagcaggagagcctgctgacgggcctgcagctcatc
aaggtcaaaggcagctccttcgccggcttcatccgcgacgagtacacgaccctgccggag
acgcaggaccgtccgctctttatctggctgaacatcggatggacgtataaggacgagaag
gatgcgatcgatccgaagaacggaagctacgccgcatcggagcagatccgggatattgcg
cacacggtgttccatgaagcgaactccccgtcgattcagcatttgatctaccggatcggg
ctgcgcatcctggagcggttcccgcagctggccgaggtacgcttcgagtcgaacaaccgg
acttgggagacggtggttgagagtgtggacggctcggacgcaagagtctatacggagccg
cgcccgccgtacggcttccagggcttctcgatgacgcaggaggacctggccgccgccgca
ggcggagaggacggcgaggcggcagcggcgctcgagaccgcagcatcggagcgttcggag
gctcccacctcatga

DBGET integrated database retrieval system