KEGG   Paenibacillus mucilaginosus K02: B2K_17915Help
Entry
B2K_17915         CDS       T02041                                 

Definition
(RefSeq) ferredoxin
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2K_17915
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2K_17915
   00020 Citrate cycle (TCA cycle)
    B2K_17915
   00620 Pyruvate metabolism
    B2K_17915
   00640 Propanoate metabolism
    B2K_17915
   00650 Butanoate metabolism
    B2K_17915
  Energy metabolism
   00680 Methane metabolism
    B2K_17915
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    B2K_17915
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     B2K_17915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4044394..4045407
Genome map
AA seq 337 aa AA seqDB search
MRVLPKTNDLGFFEIRLESIGGLGANLAGKMLAEAGVVGSGFNGVSFSSYGSEKKGSPVK
AHIRFCDLNTNIRDTTPVERPHVVGVFHENLSKTVNVISGMYEDSLVLVNSPKSPAELKE
KLKLVGGTIAVVDATGIALEEKNRVNMAMLGGLFRLCEFLDFEHMKGIIRKSLEKKYPGA
VEPALRTFQRGYDEVQFQTFSLPEGLEMPMPKRWDIPVYGYETQAIGGMVSNPGNSILKD
LSISRSGMMPHFDEEKCIHCAACDTACPDFCFVWDEAADKKGRPQMFLQGIDYQYCKGCL
KCVVACPTEALTSNRETDGYGEAHRIPHRFRLAAKSV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttaccgaaaacgaatgacctcggtttcttcgaaatccgactcgagtccatc
ggcggcctgggtgcaaacctggcaggcaaaatgctggccgaagcgggcgtcgtcgggagc
gggtttaacggtgtcagcttctcttcctacgggtccgagaaaaagggatcgcccgttaag
gcacatatccggttctgtgatctgaacacgaacatccgggacacgacgcccgtggagcgg
ccgcatgtcgtaggcgtgttccacgagaatctgtcgaagaccgtgaacgtgatcagcggc
atgtatgaggacagtctcgtgctcgtcaactcgcccaagagtccggcggagctgaaggag
aagctgaagctggtcggcggcacgatcgccgtggtcgatgcaacgggcatcgcgctcgag
gagaagaaccgggtcaacatggccatgctcggcggtctgtttcggctctgtgagttcctt
gattttgaacacatgaaaggcatcatccgcaagtccctggagaaaaaataccccggcgcc
gtcgagcccgccctgcggacgttccagcgcggatacgatgaagtgcagttccagaccttc
tcgctgcccgaaggcctcgagatgccgatgccgaagcggtgggatatcccggtatacggc
tatgagacgcaggcgatcggcgggatggtgtccaacccaggcaactcgatcctcaaagac
ctgagcatctctcgcagcgggatgatgcctcacttcgatgaagaaaaatgcattcactgc
gccgcctgtgatacggcctgtcccgacttctgcttcgtatgggacgaggccgccgacaag
aaaggccgtccgcagatgttcctgcagggcattgactaccagtactgcaagggctgtctg
aagtgtgtggtggcctgtccgactgaagcgcttacatccaaccgggagacggacggctat
ggggaagcccaccgtattccgcaccggttccggctcgcagcgaagtccgtataa

DBGET integrated database retrieval system