KEGG   Paenibacillus mucilaginosus K02: B2K_23580Help
Entry
B2K_23580         CDS       T02041                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5638004..5639506
Genome map
AA seq 500 aa AA seqDB search
MVSLSTHIDPESGYRAMRNMPNHIVVIGGGITGLTAAYELNKRAAGENRPLRVTLIEREP
RLGGAVRTLRQDGFVIEQGPDSFLSRKPETLLLARELDLEEQLVGLNPDAARSYMYRNGR
LQPLPEGLSMGIPTRVLPFLGTGLLSYRAKARAALDLVLPRRTALGDEPLGGLIGRRMGR
EVADGLVGPILAGIYAGDVHKLSTAATFPQLLSLESRHRSLILGMLASKRMPKSPVHGRT
EPELPPRLRGSLFLTFSSGLGALVERLTEELVRQGTVIRQETSASAISPSGESGRAYRVT
LSDGAELHADAVILAVPAHTAAMLLKGRSRSLNRCLASIQGVSVANVALGLDGRRLRAPL
RGSGFVAPRGSGLRITACTWTSVKWPHTAPPGKLLLRAYLGHAGDETHCGHGDDALTAAV
LEDLGRILGEELRPDFSVVSRHPAAMPQYECGHLERLHGMESELLAQWPNVVLAGKSYRG
TGMPDCIRQGMDAAEKIRLR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgctgtccacacacattgatcctgaaagcgggtaccgtgccatgcgaaacatg
cctaatcatatcgtcgtgatcggaggcggcatcaccggattaacggccgcctatgaattg
aacaagcgtgccgccggagagaaccggccgctccgggtaaccttgatcgaacgggagccc
cgtctggggggcgcggtccggacgctgcggcaggacggattcgtgatcgagcaaggcccc
gactccttcctgtccagaaagcccgagacgctccttctggcccgggagctcgacctggag
gagcagctggtggggctcaatcccgatgcggcccgcagctatatgtaccggaatggccgg
ctgcagcctctgcccgaagggctgtcaatgggcatccccacccgggttctgccgttcctc
ggaaccgggctgctctcgtacagggccaaagcgcgcgccgcgctggatctggtgctcccc
cgccggacggcgcttggagacgagccgctgggcgggctgatcggcaggcgcatgggccgg
gaagtggctgacggccttgtgggccccatcctggccggcatctatgccggcgacgtgcac
aagctgagcacggccgcgaccttcccccagctgctctccctggaatcccgccaccgcagt
ctcattctcggcatgctggcttccaagcgcatgccgaaaagccccgtgcacggccgcacg
gaacctgagcttccgccccggctgcggggcagcctgttcctcaccttcagctcggggctc
ggcgccttggtggaacgtctgacggaagaactggtccgccagggcaccgtcatccggcag
gagacttccgcgtcggccatcagcccctcgggggagtccgggagggcctaccgcgtgacc
ttgtcggacggagccgagcttcatgccgatgcggtcatcctggcggttcccgcccatacg
gcagccatgcttctaaaaggccggtcccgttccctgaaccggtgcctggcctccatccag
ggcgtctccgtcgccaatgtggccctcggcctcgacggccgcaggcttcgcgcccccctg
cgcgggtcgggcttcgtcgctccccgcggcagcggtctccggattacggcctgcacctgg
acatcggtcaagtggccccataccgctccgcccggcaagctcctgctccgtgcctatctt
gggcatgcaggcgatgaaacccactgcgggcacggtgacgacgccctgacggcagcggtc
ctggaggacctcggccgcattctcggcgaagagctccggccggatttcagcgtggtgtcc
aggcatccggccgcgatgccccagtatgaatgcggccacctggagcggctgcacggcatg
gaatccgagctgctggcgcagtggcccaatgtcgtcctcgccggcaaatcctacaggggg
acgggcatgcccgactgcatccggcaggggatggacgcggcggagaagatccggctgaga
taa

DBGET integrated database retrieval system