KEGG   Paenibacillus mucilaginosus K02: B2K_23580Help
Entry
B2K_23580         CDS       T02041                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B2K_23580
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     B2K_23580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5638004..5639506
Genome map
AA seq 500 aa AA seqDB search
MVSLSTHIDPESGYRAMRNMPNHIVVIGGGITGLTAAYELNKRAAGENRPLRVTLIEREP
RLGGAVRTLRQDGFVIEQGPDSFLSRKPETLLLARELDLEEQLVGLNPDAARSYMYRNGR
LQPLPEGLSMGIPTRVLPFLGTGLLSYRAKARAALDLVLPRRTALGDEPLGGLIGRRMGR
EVADGLVGPILAGIYAGDVHKLSTAATFPQLLSLESRHRSLILGMLASKRMPKSPVHGRT
EPELPPRLRGSLFLTFSSGLGALVERLTEELVRQGTVIRQETSASAISPSGESGRAYRVT
LSDGAELHADAVILAVPAHTAAMLLKGRSRSLNRCLASIQGVSVANVALGLDGRRLRAPL
RGSGFVAPRGSGLRITACTWTSVKWPHTAPPGKLLLRAYLGHAGDETHCGHGDDALTAAV
LEDLGRILGEELRPDFSVVSRHPAAMPQYECGHLERLHGMESELLAQWPNVVLAGKSYRG
TGMPDCIRQGMDAAEKIRLR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgctgtccacacacattgatcctgaaagcgggtaccgtgccatgcgaaacatg
cctaatcatatcgtcgtgatcggaggcggcatcaccggattaacggccgcctatgaattg
aacaagcgtgccgccggagagaaccggccgctccgggtaaccttgatcgaacgggagccc
cgtctggggggcgcggtccggacgctgcggcaggacggattcgtgatcgagcaaggcccc
gactccttcctgtccagaaagcccgagacgctccttctggcccgggagctcgacctggag
gagcagctggtggggctcaatcccgatgcggcccgcagctatatgtaccggaatggccgg
ctgcagcctctgcccgaagggctgtcaatgggcatccccacccgggttctgccgttcctc
ggaaccgggctgctctcgtacagggccaaagcgcgcgccgcgctggatctggtgctcccc
cgccggacggcgcttggagacgagccgctgggcgggctgatcggcaggcgcatgggccgg
gaagtggctgacggccttgtgggccccatcctggccggcatctatgccggcgacgtgcac
aagctgagcacggccgcgaccttcccccagctgctctccctggaatcccgccaccgcagt
ctcattctcggcatgctggcttccaagcgcatgccgaaaagccccgtgcacggccgcacg
gaacctgagcttccgccccggctgcggggcagcctgttcctcaccttcagctcggggctc
ggcgccttggtggaacgtctgacggaagaactggtccgccagggcaccgtcatccggcag
gagacttccgcgtcggccatcagcccctcgggggagtccgggagggcctaccgcgtgacc
ttgtcggacggagccgagcttcatgccgatgcggtcatcctggcggttcccgcccatacg
gcagccatgcttctaaaaggccggtcccgttccctgaaccggtgcctggcctccatccag
ggcgtctccgtcgccaatgtggccctcggcctcgacggccgcaggcttcgcgcccccctg
cgcgggtcgggcttcgtcgctccccgcggcagcggtctccggattacggcctgcacctgg
acatcggtcaagtggccccataccgctccgcccggcaagctcctgctccgtgcctatctt
gggcatgcaggcgatgaaacccactgcgggcacggtgacgacgccctgacggcagcggtc
ctggaggacctcggccgcattctcggcgaagagctccggccggatttcagcgtggtgtcc
aggcatccggccgcgatgccccagtatgaatgcggccacctggagcggctgcacggcatg
gaatccgagctgctggcgcagtggcccaatgtcgtcctcgccggcaaatcctacaggggg
acgggcatgcccgactgcatccggcaggggatggacgcggcggagaagatccggctgaga
taa

DBGET integrated database retrieval system