KEGG   Paenibacillus mucilaginosus K02: B2K_26510Help
Entry
B2K_26510         CDS       T02041                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00900  Terpenoid backbone biosynthesis
pmw01100  Metabolic pathways
pmw01110  Biosynthesis of secondary metabolites
pmw01130  Biosynthesis of antibiotics
Module
pmw_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B2K_26510
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     B2K_26510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AFH64200
UniProt: I0BPA3
Position
complement(6318394..6319542)
Genome map
AA seq 382 aa AA seqDB search
MKKISILGSTGSIGTQTLDVVSHYPELYSVEGLAGGHNLPLLQQQIERFRPRKVSVATPE
LAQELARQVPAGVQVYSGPEGLTEIAAGTDAELVVTAVVGSQGLHPTLAAIEAGKHIGLA
NKETLVSGGHLVTEAARRKGVSLLPIDSEHSAIFQCLNGESMEDIHKITLTASGGSFRDR
TREQLVGVTVQDALNHPNWSMGAKVTIDSATMVNKGLEVMEAHWLFGLSYDRIDVLIHPE
SIIHSFVEFEDYSIIAQLGMPDMRVPIQYALTYPRRMKTPSERLRLSEIGRLNFRAMDFD
RFPCLRMAYDSGRAGGSMPTVFNAANEVAVERFLQGEIAFLDIERIIEEAMSRHDTIPDP
DLDAITEIDQWARETARGAARR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagatcagtattctgggctcgaccggatcgatcggcacccagacgcttgatgta
gtatcgcattacccggagctgtattcggtggaagggttggcgggcggccacaatctgccc
ctgctgcagcagcagatcgaacgcttccggcctcggaaggtgtcggtagccaccccggag
ctggcgcaggagcttgcacgacaggtgccggcaggcgtgcaggtgtattccggaccggaa
gggctgaccgagattgcggccggcaccgacgcggagctggtggttaccgccgtagtcgga
agccaggggcttcacccgacgctggcggcgatcgaggccggcaagcacatcggtcttgcc
aataaggagacgctggtgagcggcgggcacctggtgacggaggcggcacggcgcaagggt
gtcagcctgctgccgatcgacagcgagcattcggcgattttccagtgcctgaacggggaa
tcgatggaagacatacataaaatcaccctgacggcatcgggcggctcgttccgtgaccgc
actcgcgaacagctcgtcggtgtcacggtgcaggatgcgctgaaccatccgaactggtcg
atgggcgcaaaggtcacgatcgactcggccacgatggtgaacaaggggcttgaggtcatg
gaagcgcactggctgttcgggctctcgtatgaccggattgacgtgctgatccatccggag
agcatcatccactccttcgtggaattcgaggattacagcatcatcgcccagctgggcatg
ccggatatgcgggtgccgatccagtacgcgctgacgtatccccggaggatgaagacgcct
tcggagaggctgcgcctgtccgagatcgggcggctgaacttccgggcgatggactttgac
cggttcccctgcctgcggatggcttatgacagcggacgtgcggggggctcgatgcctacc
gtctttaacgcggccaacgaggttgcggtggaacgcttcctgcagggggaaattgcattc
cttgatatcgaacggattatcgaggaggccatgagccggcacgacaccatcccggatccg
gatctggatgccatcacggagatcgaccagtgggccagagagacggctcgcggagcggcc
agacggtag

DBGET integrated database retrieval system