KEGG   Paenibacillus mucilaginosus K02: B2K_27200Help
Entry
B2K_27200         CDS       T02041                                 

Definition
(GenBank) histidine kinase
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw02020  Two-component system
pmw02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B2K_27200
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    B2K_27200
Enzymes [BR:pmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     B2K_27200
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     B2K_27200
Two-component system [BR:pmw02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   B2K_27200
Bacterial motility proteins [BR:pmw02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    B2K_27200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest PAS_10 HATPase_c PAS_9 PAS_4 CheR_N HisKA PAS PAS_3 IncA CENP-F_leu_zip KASH_CCD PAS_8 Spc7 Golgin_A5 Methyltransf_12 HATPase_c_5 APG6 OmpH DUF3552 Mnd1 HATPase_c_3 Fez1 IFT57 MAD Not3 HPTransfase CALCOCO1 HOOK Rootletin HATPase_c_2 DUF3584 HMMR_N SHE3 Exonuc_VII_L Seryl_tRNA_N GAS MCC-bdg_PDZ Laminin_II FlgN ATG16 Mod_r DUF3450 Fmp27_WPPW UPF0449
Motif
Other DBs
NCBI-ProteinID: AFH64336
UniProt: I0BPN9
Position
complement(6458064..6461660)
Genome map
AA seq 1198 aa AA seqDB search
MSTILSEQDVQEQSPPGGFIVGIGASAGGLEALQQFFDHMRPDCGLSFVVVQHLSPNYKS
FMAEILTKNTSMNIYEAEHLMEVRPNCVYLIPPKKDMTIAGRTLQVTEHRQTTGLNLPID
MFLTSLAKDIGSRAIGVILSGTGSDGTRGVEAIKEHGGLVIVQDELTAKFDGMPNSARLT
GIVDQVMTPQAMADYLIEWTTGDPEIEWEDGESDPGSSGRLDLLSLPSFLELLKNASGID
FSYYKENSILRRIERRMNLLGVTTSDAYLRLLGNQPDELASLSKDLLIGVTHFFRDPEAF
EILRVKVLPAIIENKKREGHIRIWVAGCSTGEEAYSLAMLFDELISGQELPYTVKIFATD
LDRDSIEYASQGVYPESAVRSVPSELLQQHFTQVGENYQVSKSIRKMVVFAPHNITKDPP
FSNLDLVTCRNMLIYLQSDVQQKVLSLFHFALNPNGFMFLGPSETVGKLSSLFYAFDRKW
NIFQQRSRMSGSPIPSAVEVSDSVDITKVHQLARRGYTTLREIPAYRKPDDLYTSFVDEH
MPPCMVLDENNEVLHLSGNINPYLALARGKPSWNIYKMVEAHLAVAIVTAVQKVRKEQRT
IYYQDIRLNNSDQSPYINLTVKPFSTKNKKFDRLVLVTFEDADLPPPAPQIPEAFDMDHN
VNQRIVELEQELQRAEESLQATIEELETSNEELQATNEELVAANEELMSTNEELQSVNEE
LVTVNTEYQYKIQELTDLNNDMDNFLVSTKIGTIFLDKEMRIRRFTPAITREINLLEVDY
GRPIRHISHNFLYEGIVQDAETVLRTLVPVEKEIQSRSGSWYMLRVLPYRTGDHFIKGIV
LTFVDITELKSANEELLKLSHAIEQSPSITLLANLEGIIMYANPKFAEVTGHAQSEMIGV
HFRELNDWQASSVSFTEVWSTLSSGREWRGELHSRRKDGETYWESVRFLPIKDGEGRTQH
YLRIAEDISDRKQTEELLRKSEMLSAVGQLAAGIAHEIRNPLTALKGFTKLMGTGGHNES
YLAIMSAELERIEEIVSELLVLAKPQAVDYLPKSVPSILQDVIMLLDTQAIISNVEIETE
IDEPLPYVSCVENQLKQVFINVLKNSVEAMPKGGTITVRAKRTEDRRLRVSFIDQGLGIP
ESKLARIGEPFFTTKNKGTGLGLMVSYKIIENHQGTMQISSKEGVGTTVEILLPALSS
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattctatcggaacaggatgtgcaggaacaatcccctcccggcggatttatc
gtcgggatcggcgcatccgcgggggggcttgaggcgcttcagcagttttttgaccatatg
aggcccgactgcgggctttctttcgttgtcgttcagcacttgtctccgaattacaagagc
tttatggccgagatcctgacgaagaacacatccatgaatatttatgaggcggagcatctc
atggaggtgcgccccaactgcgtgtatctcattcctcccaaaaaggacatgacgatcgcc
gggcgcacgctgcaggtgaccgagcaccggcagacgaccggactcaacctgccgatcgat
atgttcttaacctcgctggccaaggatatcggcagccgggcgatcggggtgattctctcg
ggaacgggaagcgacggaacgcgcggcgtcgaggcgatcaaggagcacggcgggcttgtg
atcgtgcaggacgagcttacggccaagttcgacggcatgccgaacagcgcccgtctgacc
ggcatcgtcgaccaggtgatgacccctcaggcgatggccgactacctgatcgagtggacc
accggagatccggagatcgagtgggaggacggggagagcgacccgggcagcagcggccgg
cttgacctgctgtccctgccgtctttccttgagctgctcaagaacgcaagcgggattgac
ttcagctactacaaggagaacagcatcttacgccggatcgagcggcggatgaatctgctc
ggcgtcaccacctccgatgcctacctgcgcctgctcgggaaccagccggacgagctggcg
agcctgagcaaggatctgcttatcggcgtgacgcattttttccgggacccggaggccttc
gagatccttcgcgtcaaagtgctgccggccattatcgagaacaagaagcgggaggggcac
atccgcatctgggtggccggctgctcgaccggtgaggaggcctattctctggccatgctt
ttcgatgagctgatctcggggcaggagctgccttacacggtgaagatttttgctacggat
ctcgacagggattcgatcgagtatgcctcccagggggtatatcccgaatccgccgtgcgg
agcgttccttccgagcttctgcagcaacacttcacccaggtcggcgagaactaccaggtg
agcaagagcatccgcaagatggtcgtgtttgctccccataacattaccaaggacccaccg
ttcagcaacctggacctggtgacctgccgcaatatgctgatctaccttcagtccgacgtg
cagcagaaggtgctgtccttgtttcattttgcgctgaatccgaacggctttatgttcctt
ggcccgagtgagacggtgggcaagctgagctccctgttctacgccttcgaccggaagtgg
aacatcttccagcagcgcagccggatgtccgggtccccgattccgagtgcggtggaggtc
agcgacagcgtggacatcacgaaggtgcaccagctggcgcgccgaggctacaccacgctg
agggagatcccggcgtaccgcaagcccgacgatctctacacctccttcgtggacgagcat
atgccgccctgcatggtcctcgacgagaacaacgaggtgctccatctcagcggcaacatc
aacccctatctggcgctggcccggggcaagccgagctggaacatctacaagatggtggag
gcgcatctggcggtggcgatcgtcaccgcggtgcagaaggtacgcaaggagcagcggacg
atctactaccaggacatcaggctgaataattccgatcagtcgccttacatcaatcttact
gtgaagccgttttcaaccaaaaacaaaaagttcgaccggctcgtgctcgtcaccttcgag
gatgcggatctgccgccgccggccccgcagattcccgaagcgttcgatatggaccacaac
gtgaaccagcggatcgtcgaactggaacaggagctgcagcgggcggaggagtctcttcag
gcgaccattgaagagctggagacgtccaacgaggagctgcaggcgaccaatgaggagctt
gtcgcagccaatgaggagctcatgagcaccaacgaggagctgcagtcggtgaacgaagag
ctcgtcacggtgaacacggagtaccagtacaagatccaggagctgacggacctcaacaac
gacatggacaacttcctggtgagcacgaagatcggcacgatttttctcgataaagaaatg
cgcatccggcgcttcacgccggcgatcacccgggagatcaatctcctcgaggtggattac
ggccgtccgatccggcacatctcgcataatttcctgtacgaaggcatcgtgcaggacgcg
gagacggtgcttcggaccctcgtgccggtcgagaaggaaatccagagccgcagcggcagc
tggtacatgctgcgcgtgctgccttaccggacgggcgatcacttcatcaagggcatcgtg
ctgacgttcgtcgacattacggagctcaaatcggcgaacgaagagctgctgaagctctcg
cacgccatcgagcagagcccttcgatcacgctgctggccaatctcgaggggataatcatg
tacgcgaaccccaagttcgccgaggtgaccggacatgcccagtccgagatgatcggcgtc
cacttccgggagctcaacgactggcaggcctcctcggtctccttcaccgaggtctggagc
accctgagctccggccgggaatggagaggcgagctgcacagccgccgcaaggacggggag
acgtattgggagtcggtgcggttcctgccaatcaaggacggcgagggacggacccagcat
tacctgcggatcgccgaggatatctccgaccgcaagcagaccgaggagctgctgcgcaag
agcgagatgctctcggccgtcggccagctcgccgccggcatcgcgcacgagatccgcaac
ccgctcacggcgctcaagggcttcaccaagctgatgggcaccggcgggcataacgagagc
tacctggccatcatgtcggcggagcttgagcggatcgaagagatcgtgagcgagctgctc
gtgctggcgaagccgcaggccgtcgattatttgccgaagtcggtgccctcgattctccag
gacgtcatcatgctgctcgatacgcaggcgatcatctcgaatgtggagatcgaaacggag
atcgacgagccgctgccgtatgtgagctgcgtggagaaccagctcaagcaggtgttcatc
aacgtgctcaagaacagcgtcgaggcgatgccgaagggcgggacgatcacagtccgcgcg
aagcgtacggaagaccggagactgcgggtctccttcatcgaccagggactcgggatcccc
gagagcaagctggcccggatcggcgagcccttcttcaccacgaagaacaagggcacgggc
ctcggactcatggtgtcgtacaagatcatcgagaaccatcaaggcacgatgcagatctcc
tcgaaggagggcgtcggcaccacggtggagatcctgctgccggcgctgagctcctga

DBGET integrated database retrieval system