KEGG   Paenibacillus mucilaginosus K02: B2K_27595Help
Entry
B2K_27595         CDS       T02041                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmw01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmw00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6546688..6547602
Genome map
AA seq 304 aa AA seqDB search
MSAVKDISVLCVPFDLGAGRKGVRLGPHAILQAGLERRLRGLGLQVEVLQPFPVPQAGIS
EPAVRTEEALLHLDEVAGLNELLAQAVWGILGRGRFPLVLGGDHSIAIGTLAGIAPHHKN
PGVIWFDAHSDLNTPETSPSGNIHGMSLAAALGLGHDRLVRIGGITPKVKPEHTVIIGAR
SLDPGEKERIRSLGIRCFTMHEIDRMGISRVMEEALHIAGAGTDGIHVSFDIDSMDPGEA
PGTGTPVRGGLSYREAHCALEMLSESGLVRSAEVVEVNPVLDTDNKTARLAAELMGSLLG
QRIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagtaaaggacatctctgtcctgtgtgtcccctttgatcttggggccggacgc
aagggcgtacgcctcgggccgcatgccatcctccaagccggactcgaacgccggctgcgc
gggctgggcctccaggtggaggtgctgcagccgttccctgtaccgcaggccggcatatcc
gagcccgccgtccggacggaagaggcccttctccacctggatgaggtcgccggactgaac
gagctgctggcccaggccgtctggggcattctcggacggggacggttcccgctcgtgctc
ggcggagaccacagcatcgccatcggcacgctcgccggcatcgcgccgcaccacaagaac
cccggtgtgatctggttcgacgcccattcggatctcaatacccccgagaccagtccgtcc
ggcaacatccacggcatgtcccttgcggccgctttaggccttgggcatgaccggctcgtg
cggatcggcgggattaccccgaaggtcaaaccggagcacacggtcatcatcggtgccagg
tcgctcgatcccggggagaaggagagaatccggtcgctgggcatccgctgcttcacgatg
cacgagatcgaccgaatggggatctcccgcgtcatggaagaagccctgcacatcgcaggt
gccggaacagacggcatccacgtctccttcgacatcgacagcatggaccccggcgaagcc
cccggcactggcactcccgtacgcggaggactcagctaccgcgaagcgcactgcgcgctc
gagatgctgtccgaatcgggcctggtccgctcggccgaggtcgtggaagtgaatccggtg
ctcgataccgacaataaaaccgcccggctggcggccgaactcatgggctcgctgctcggc
cagcgaatcttatag

DBGET integrated database retrieval system