KEGG   Paenibacillus mucilaginosus K02: B2K_27930Help
Entry
B2K_27930         CDS       T02041                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00240  Pyrimidine metabolism
pmw00250  Alanine, aspartate and glutamate metabolism
pmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B2K_27930
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B2K_27930
Enzymes [BR:pmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     B2K_27930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFH64480
UniProt: I0BQ33
Position
complement(6614837..6615745)
Genome map
AA seq 302 aa AA seqDB search
MTQLSVHTDKHLLGTKGMTAGELTSILDRAAYWEQYPVKVSNGLQGRFVANMFFENSTRT
RFSFEVAEKRLGAEVLNFAAAVSSVQKGESIYDTVRTIESMGVDAGVIRMKPNGLLAELA
QKIKFPLINAGDGNNEHPTQALLDLYTMRKQFGEIKGLNVAIIGDIQHSRVARSNLWALQ
ALGAKVSFCAPQGMQAAELAGHAPYVTIDEALKADVVMMLRVQLERHEGTLFGSAEEYRA
AYGLTVERAARMAPHAIIMHPAPVNRGVEIDDELVECEKSKIFQQMSHGVPIRMAVIERA
LS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacacagctcagcgtacacacagacaagcatctgcttggcaccaaaggcatgacggcc
ggcgaactgacgtccattctggatagagcggcatactgggaacagtatccggtgaaggta
tcgaacggcctgcagggccggtttgtagcgaatatgttcttcgagaacagcacgagaacg
cggttctccttcgaagtcgcggagaagcgcctcggggcggaggtgctgaacttcgccgcc
gccgtctcctcggtgcaaaaaggggagtcgatctacgatacggtccgcacgatcgaatcg
atgggcgtcgacgcgggcgtcatccggatgaagccgaacgggctgctcgccgagctcgcc
cagaagatcaagttcccgctgatcaacgcgggggacggcaacaacgagcatccgacgcag
gcgctgctcgatctctacacgatgcgcaagcagttcggcgagatcaagggcctgaacgtg
gcgatcatcggcgacatccagcacagccgggtggcccgctcgaacctgtgggcgctgcag
gcgctgggcgccaaagtaagcttctgtgcgccgcaggggatgcaggccgccgagctcgcc
ggccacgccccgtacgtgacgatcgacgaagcgctgaaggcggatgtggtcatgatgctg
cgcgtgcagctcgagcgccacgaaggcacgctcttcggctcggccgaggaataccgggcg
gcctacgggctgacggtggagcgggcggcgcgcatggcgccccacgcgatcatcatgcac
ccggctccggtgaaccggggcgtcgagatcgacgacgagctcgtcgagtgcgagaaatcg
aagattttccagcagatgagtcacggcgtaccgatccggatggccgtcatcgaacgggca
ctgagctaa

DBGET integrated database retrieval system