KEGG   Paenibacillus mucilaginosus K02: B2K_28045Help
Entry
B2K_28045         CDS       T02041                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B2K_28045
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B2K_28045
Enzymes [BR:pmw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     B2K_28045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6637725..6638993)
Genome map
AA seq 422 aa AA seqDB search
MEKLVIEGGKPLSGAIKIHGAKNAALPILAAGIMAEGTVVIENVPDLSDIHVMLGILQAL
GCQAEYQGDTVTVNTMGVHEFHIPEHLMSQMRSSIFLMGPLLARLGRVELYQPGGCAIGE
RKIDLHLRGLTALGAHIEESGSKIVCTAKELRGAEIVLDFPSVGATENIMMAAATARGST
TITGAAREPEIQDLQNFLNSMGAKIMGAGTDTITIEGVPVLTPGTYRIIPDRIVAGTLMI
AAAVTKGNITLEQVCPAHMTSAIHVLKRAGVQIAISGDIMNVCAPTRPKAVERIVTSPHP
AFPTDLQSQIMVLLSLADGVSVVKETVFEGRFKHVDELSRMGADIRVDLNAAMIRGVPRL
YGATVEATDLRAGAALVIAGLAAQGTTVIEQIHHIDRGYDRIESMLSALGASIHRVSPVP
SE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagttggttatcgaaggcgggaaacctctatcgggagccatcaagattcacgga
gccaaaaacgccgcactgcctatcctggcagccggcatcatggcggaaggcaccgtagtc
attgagaatgtgccggacttgtccgatattcacgtgatgctcgggattctgcaggccctc
ggctgtcaggcggaataccagggggatacggtgaccgtgaacacgatgggggttcatgaa
ttccacattccggagcacttgatgagccagatgcggtcttcgatcttccttatgggcccg
ctgctcgcacggctcggccgggtggagctgtatcagcctggagggtgcgcgatcggagag
cgaaagatcgatctgcatctgcgcggcctgacggccctcggtgcgcatatcgaggagagc
ggcagcaagattgtttgtacggccaaggaactgcggggggcggagatcgtactcgacttc
ccgagcgttggagccaccgagaatatcatgatggccgccgccacggcccggggttccacc
acgattacgggagcggcgcgcgagcccgagattcaggacctccagaacttcctgaattcc
atgggcgccaagattatgggggcggggacggacacgatcaccatcgagggtgtgccggta
ctgaccccgggcacctaccggatcatcccggaccggattgtcgccggaaccctcatgatc
gccgcagccgtcacgaaggggaacattacgctggagcaggtgtgtccggcgcatatgacc
tcggcgattcacgtgctgaagcgcgcaggtgttcaaatcgcaatcagtggtgatataatg
aacgtatgcgctcccacccgtcccaaagcggtggagcggatcgtgacatcgccgcacccg
gccttcccgaccgatctgcagtcgcagattatggtgctgctgagcctcgcagacggggta
agcgtagtgaaggaaacggtttttgaaggaagattcaagcacgtggatgaactctcccgc
atgggagccgacatccgggtggatctcaatgcggccatgatccggggcgttccccggctg
tacggggccacggtggaagccacggaccttcgtgcgggagcggctctggtgatcgccggc
cttgcagcgcaggggacgacggtgatcgaacagattcatcacatcgaccgcggttacgac
cggatcgagtctatgctgagtgcactcggcgcaagcattcacagggtatcaccggtacca
tcggagtaa

DBGET integrated database retrieval system