KEGG   Paenibacillus mucilaginosus K02: B2K_29390Help
Entry
B2K_29390         CDS       T02041                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B2K_29390
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     B2K_29390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6947711..6949450)
Genome map
AA seq 579 aa AA seqDB search
MKPFRLWGAWLSTAVAVLGLMLPFGAAYSQAAAAVPYGQLKVQGADLLGESGQRVQLRGM
SSHGIHWYGDLVNPGSLKWLKEDWNSNLFRVAMYTAEKGYITDPSVKEKVKEAVQAAIDL
GLYVIIDWHILTDGDPNTYKTQAKAFFQEMAALYGQYPNVIYELCNEPNGNVTWAGQIKP
YAQELTQAIRAIDPDNIIIVGTPNWSQDVNQAADSPLPYGNIMYAAHFYAGTHGQWLRDK
IDYARSKGAAVFVTEWGASDASGDGGPFLREAQEWIDFMNSRGISWANWSLADKEETSAA
LLPGANPSGGWPASQLSASGQFVRSKLRESLVSVPAAPAGLQAAPGSGQAALSWNAVNGA
TGYIVKRAAVSGGPYTTVAELTGTSYTDTGLANGTTCYYVVSAKNAAGTGPVSAQVSVQP
AAGQGGGGTPVPGSLVLQYRAADTNAGDNAIKPHFNIRNTGASPVDLSGVKLRYYFTKDG
IQPLSFAVDWAQVGSPNVKGTFGSASGAGADTYLEVSFTGGSIPAGGQTGEIQTRIHKSD
WSSFQESGDYSYDPGKTSYADWSKVTLYRDGTRVWGVEP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccattccgcttatggggggcatggctcagtaccgcggttgcggtcctcggcctg
atgctgccgttcggtgcagcatacagccaggcggctgcggccgttccttacggccagctg
aaggtgcagggggccgacctgctgggcgagagcgggcagcgcgtccaactgagggggatg
agctcccacggcatccactggtacggggatctcgtgaacccgggcagcctcaagtggctc
aaggaagactggaactccaacctgttccgggtggcgatgtacacggcggagaaggggtat
atcaccgacccttcggtgaaggagaaggtgaaggaggcagtgcaggctgccattgacctc
gggctgtatgtcatcatcgactggcacatcctgaccgacggggacccgaacacctacaag
acgcaggccaaagcgttcttccaggagatggccgcgctgtacgggcagtatccgaatgtc
atctatgagctgtgcaacgagccgaacgggaacgtgacctgggcgggccagatcaagcct
tacgcgcaggagctcacccaggcgatccgggcgatcgacccggacaatatcatcatcgtc
ggcacgccgaactggagtcaggatgtgaaccaggcggcggacagcccgctgccgtacggc
aacatcatgtatgcggcccatttctacgcgggtacgcacggccagtggctgcgcgacaag
atcgactatgcgcggagcaagggagcggcggtattcgtcaccgagtggggggcgagcgac
gcttcgggggacggcggaccgttcctccgtgaggcgcaggagtggatcgacttcatgaac
agccgaggcatctcctgggcgaactggtcgctggccgacaaggaggagacttccgccgcg
ctgctgccgggagcgaatccctccggcgggtggccggcttcgcagctcagcgcctccggc
cagttcgtgcggagcaagcttcgcgagagcctggtgagcgtgccggccgcccctgcggga
ctgcaggccgcccccggcagcgggcaggccgccctgagctggaatgccgtcaacggagcg
acgggctatatcgtgaagcgggcggcggtcagcggcggtccgtacaccacggtcgccgag
ttgacggggacctcgtacacggacacgggcctcgctaacgggacgacctgctattatgtc
gtcagcgcgaagaacgcggcgggcaccggtccggtctcggcccaggtgagcgtgcagccg
gcagccggccagggaggcggcggcacgccggtaccgggcagcctggtcctgcagtaccgc
gccgccgacacgaacgcgggggataacgcgatcaagccgcattttaacatccgcaatacg
ggtgcttctcctgtggatctgagcggagtgaagctccgctactacttcacgaaggacggg
atccagccgctgagcttcgcggtggactgggcgcaggtcggcagcccgaacgtcaagggg
acgttcggcagcgcctcgggcgccggagcggacacatacctggaggtgagcttcacgggc
ggcagcatcccggccggcggccagacgggcgagatccagacccgcattcacaagagcgac
tggtcgagcttccaggagtctggagattactcgtacgatccggggaagacctcgtacgcg
gattggagcaaggtgacgctctaccgggacggcacaagggtctggggcgttgagccataa

DBGET integrated database retrieval system