KEGG   Paenibacillus mucilaginosus K02: B2K_29530Help
Entry
B2K_29530         CDS       T02041                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B2K_29530
Enzymes [BR:pmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     B2K_29530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6978578..6979864)
Genome map
AA seq 428 aa AA seqDB search
MKFGLLPPADQIVLFMERIYGYGMTTTSGGNLSIRDDNGDIWITPAGVDKGALTRQDIVC
VKPDGQVVGAHRPSSEFPFHQRIYRDRPDLRAVVHAHPPALVAFSIVRRIPDTRLLPDEH
EICGEVGMAAYAVPGSAELGERIAEVFARGIDTVMLENHGVVAGGGDLFEAFQRFETLEF
CARLEIEASRIGTPVRLAAEDIAKARACRELPLEPFTAAGYPTREREAREMMCRLIRRSY
DQRLFTSTQGTYSERIGGDAFLITPHGMDRKYLEPQDLVRIEGGRAEAGKKPSRSHLLHR
HIYEAHPHVNSVLIAHPPSIMAFAVTDADFDSRTIPESYLLLRRMPKLPFHAVYDDPETA
AAVFTKDTPIAIVRNNFVIVTGDSLLSAFDRLEVAEYSARSMIAAQSLGAVVHMDEERIG
ELEKAFGL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggacttcttcctcctgcggaccagatcgtcctcttcatggagcgcatctac
gggtacgggatgacaacgacctccggcggcaatctctccatccgggacgacaacggagac
atctggatcactccggcgggcgtggacaaaggcgcgctgacccgccaggatatcgtctgc
gtgaagccggacggacaggttgtcggcgcccacaggccgtccagcgaattcccgttccac
cagcggatctaccgggaccggccggacctgcgggccgtggtgcatgcgcacccgcccgcg
ctggtggccttcagcatcgtgcgccgcatcccggacaccaggctgctcccggatgagcac
gagatctgcggagaggtgggcatggcggcttacgcggttccgggcagcgccgagctcggc
gaacggatcgcggaagttttcgcacgggggatcgacacggtaatgctggagaatcacggc
gttgttgccggcggcggcgatctgttcgaggcattccagcggttcgaaacactggaattc
tgcgcgcggctggagatcgaggcgagccgcatcggaacgccggtccggctggccgcagaa
gacatcgccaaggcgcgggcctgccgggagctcccgctggagccgttcaccgcagccgga
tacccgacgcgggagcgggaggcgagggagatgatgtgccggctcatccggcgctcctat
gaccagcggctgttcaccagcacgcagggaacgtactcggagcggatcggcggggatgct
tttctgatcacgccccatgggatggaccgcaagtacctcgagccccaggacctcgtgcgg
atcgaaggcgggagggcggaggccggcaaaaaaccaagccgctcgcacctgctccaccgc
catatttatgaggcgcacccgcatgtgaattccgtgctgatcgcccatccgccgagcatt
atggcttttgccgtcacggatgcggacttcgattcccggaccatccccgagagctatctg
ctgctccgccggatgccgaagcttccgttccacgccgtgtatgacgatccggagacggct
gcggccgtcttcaccaaggatacgccgatcgccatcgtgcgcaataactttgtcattgta
acgggagacagcctgctgagcgcgttcgaccggctggaggtggcggaatacagcgccagg
tcgatgatcgcggcgcagagcctgggagctgtagtgcatatggacgaagaacggatcggg
gagcttgagaaggcttttggattgtaa

DBGET integrated database retrieval system