KEGG   Paenibacillus mucilaginosus K02: B2K_30635Help
Entry
B2K_30635         CDS       T02041                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7258214..7258861)
Genome map
AA seq 215 aa AA seqDB search
MIDFLRGPVVYRDTEYVVLDVNGVGYRIFCANPFGVAPSKDGRDGGEVTMFIHYHVREDA
HLLFGFTTREEQSLFRLLLDVSGIGPKVAIGVLAGGRPETIAGAIRQENLSFLTKLPGIG
KKTAQRMVLDLKDKLGAITGGLDEGLFAPSEPLSAVPEGQGAWGEAKAALMALGYTEAEA
DRAGSAIKGKLKGGETADAVTKLALQALFQESMMR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattttttgaggggaccggtggtctaccgcgacacggaatatgtcgttctggac
gtgaacggcgtgggataccgcatcttctgcgccaacccgttcggtgtggcgccgtccaag
gacggcagggacggcggtgaagtgacgatgttcatccattaccatgtgcgggaagatgcg
cacctgctcttcggcttcacgacacgtgaggagcagtcgctgttccgcctgctcctggac
gtctcgggaatcgggccgaaggtggcgatcggcgtgctggccggcggccggccggagacg
atcgcgggggcgatccggcaggagaacctcagctttctcacgaagctgccgggcatcggc
aagaagacggcgcagcgcatggtgctcgaccttaaggacaagctcggggcgattaccggc
gggctcgacgaagggctgttcgcaccgagcgagccgctgtcagccgtgccggagggccag
ggcgcctggggcgaagccaaggcggcgctgatggcgctcgggtatacggaggccgaagcg
gaccgtgccggcagcgccatcaagggcaagctcaagggcggcgagacggcggatgccgtc
acgaagctggcgctgcaggcgctgttccaggaatcgatgatgagataa

DBGET integrated database retrieval system