KEGG   Paenibacillus mucilaginosus K02: B2K_30870Help
Entry
B2K_30870         CDS       T02041                                 

Definition
porphyrin biosynthesis protein HemD
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B2K_30870
Enzymes [BR:pmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     B2K_30870
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     B2K_30870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7309182..7310687)
Genome map
AA seq 501 aa AA seqDB search
MVGAGPGDPKLITLRGLEAIQRADVVVYDRLASPRLLKHMKPGAEKIFVGKLPDKHMLKQ
EEINQLLVDLALQGKTVTRLKGGDPSVFGRVGEEAELLAENEILFEIVPGITSSIAVPAY
AGIPVTHRDFTSSFSIVTGHEYKNKTYNTVNWPNLAQASGTLIFLMGVANLEHICTQLME
GGKSPDTPVALIRWGTWMEQETLTGTLTDIVEKVRAAGFQSPAVTIVGEVVRLREKLAWF
EKKPLFGRRILVTRARSQSSELSAQIDELGGEAVEFPVIRTQPSSKPEAQAARDEAMRSL
GGFDWIFFTSVNGVESFFQRLRELKVDIRSMGGARIAAVGPKTAAALEDRGLVVQTIPSE
FQGAALLEALDGELKPGQQVLLPTADIAREELPEGLRARGLHVTKIDIYETVLETEGGAE
VLELLRQKAIHIVTFTSSSTVTNLIRALQEAGEAQPLELLRGCRIACIGPVTAETAVEVG
LQVDHIAKEATVASLVASLYE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttggtgggcgccgggcccggggatccgaagctgattacgcttcgggggcttgaggcgatt
cagcgggcggatgtcgtggtgtatgaccgattggcaagccctcggcttctcaagcacatg
aagccgggagccgagaagatcttcgtaggcaagctgccggacaagcatatgctgaagcag
gaagagatcaaccagctgctggtggacctcgcgctgcagggcaagaccgttacccgcctc
aagggcggggaccccagcgtcttcgggcgggtaggggaagaagcggagctcctggccgag
aatgaaatcttgttcgagatcgtgccgggcatcacgtcttcgatcgccgtgccggcctat
gccggtattccggtgacgcacagggactttacgtcttccttctcgattgtgacgggacac
gaatacaagaacaagacctacaatacggtcaactggccgaacctggcccaagcctccggc
acactgatcttcctgatgggtgtagccaacctggagcatatctgtacgcagcttatggag
ggcggcaagtcgccggatacgccggtggccctcatccgctggggaacctggatggagcag
gagaccttgaccggcacgctgacggacatcgtggagaaagtccgggcagccggcttccaa
tccccggccgtcacgattgtcggcgaggtggtccggctgcgcgagaagctggcctggttt
gagaagaagccgctgttcggccgccggatcctcgtgacacgggcacgcagccagagcagc
gagctgtctgcgcagatcgatgagctcggtggtgaggccgtcgagttcccggtgatccgt
acgcagccttcgagcaagccggaagcgcaggcggcacgggatgaagcgatgcgatcgctt
ggcggattcgactggatctttttcacgagcgtcaacggagtggaatcgttcttccagcgg
cttcgcgagctgaaggtcgatatccgatccatgggcggcgcacggatcgcagcggtcggt
ccgaagacggccgccgctttggaagaccgcggactggttgttcagaccattccgtccgaa
ttccagggcgccgcgctgcttgaagcgctggacggcgagctgaagccggggcagcaggtg
ctgctgccgacggcggatatcgcccgggaggaactgccggaaggcctgcgcgccagggga
ctgcacgtgacgaagatcgacatctatgagacggtgctggagaccgaaggcggcgcggaa
gtgctggagctgctgcggcagaaggcgattcatatcgtcacctttacgagctcctcgacc
gtaacgaacctgatccgtgcactgcaggaagcaggcgaagcgcagccgctggagctgctg
cggggctgccggattgcctgcatcggcccggtgaccgccgagacggccgtcgaagtcggg
ctccaggtggaccacatcgccaaggaggctaccgtggcttcgctggtagcttcattatac
gagtag

DBGET integrated database retrieval system