KEGG   Paenibacillus mucilaginosus K02: B2K_30990Help
Entry
B2K_30990         CDS       T02041                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B2K_30990
Enzymes [BR:pmw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     B2K_30990
Peptidases [BR:pmw01002]
 Cysteine Peptidases
  Family C44
   B2K_30990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7336455..7338299
Genome map
AA seq 614 aa AA seqDB search
MCGITGWIDWNKDLTQHPSVLENMTDTLAPRGPDAAGTWIVPRCALGHRRLSVMDPANGA
QPMTRKVGENTFAVVYNGELYNAPELKKELEERGHRFRTTCDTEVLLAAYVEWGPGCVDR
FNGIFAFAAWNNEEQSLFAARDRLGVKPFFYAYTEGRLLFGSEPKAILAHPDFPAQINGE
GLAEIFAVGPARTPGHGVYKNLTELKPGHCLTLDANGLRIRAYWKLESRPHEDDVEATAA
KVQELLRDTVIRQLASDVPVCTLLSGGLDSSALTSLAASYYKDQGLGTLHTFSVDYVDND
KHFKANAFQPNADAPWIQRMTDHLGTVHHPIEFDTPELVEALRQVVSARDLPGMADVDGS
LYLFCREIKKHATVAISGEAADEIFGGYPWFHREEALNADTFPWSLATPDRVNLLSKDFV
DWVKPEQYVKERYRQALSEVPRLAGENQQQNRMREMSYLNITRFMPTLLDRKDRMSMAVG
LEVRVPFCDHRLVEYVWNIPWEIKTSGDREKGILRKALRGVLPEDVLTRKKSPYPKTHNP
NYLAAVRSWVLEILDDSSSPLLQFIDVAKIRALAEDDGGKFDLPWFGQLMTGPQLFAYLA
QVDTWLRQYKVAIR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcacgggatggatcgattggaacaaggatttgacccagcatccgtccgtt
ctcgagaatatgacggatacgctggcaccgcgcggcccggacgcggccggaacctggatc
gtgccccgctgcgcgcttggccaccggcgcctcagcgtcatggaccccgcgaacggtgcc
cagccgatgacgcgcaaagtgggcgagaacacgttcgccgttgtgtacaacggggagctt
tataacgcaccggagctcaagaaggaactcgaagaacgcggccaccgcttccggacgacc
tgcgatacggaagtgctgctggccgcctatgtcgagtggggcccgggctgtgtagaccgg
tttaacggcatcttcgcttttgccgcttggaacaacgaggagcaatcgctctttgcagcc
cgggaccggcttggggtcaagccgttcttttatgcgtatacggaaggccggctgctgttc
ggttcggagccgaaggcgattttggcgcatccggactttcccgcccagatcaacggggaa
ggcctcgcggagatcttcgcggtaggacccgcacgtacgccggggcatggagtctacaag
aacctcaccgagctgaagcccggccactgcctcaccctggacgcgaacggcctgcgcatc
cgtgcctactggaagctcgagagccggccgcatgaggacgacgtggaagcgacggcggcc
aaggtgcaggagttgctgcgggacacggtcatccgccagcttgcctccgacgtgccggtg
tgcaccctgctctccggcggactcgattccagcgcgctgacctccctggcggcatcctac
tataaagaccagggcctcggcaccctccatacattctccgttgactatgttgacaacgac
aagcacttcaaggcgaacgccttccagccgaacgcggacgccccgtggattcagcggatg
accgatcacctcggcaccgtgcaccacccgatcgaattcgatacgccggagctcgtcgag
gcgctgcgccaggtggtcagcgcgcgcgacctgccgggcatggccgatgtcgacggttcg
ctgtacctgttctgccgggagatcaagaagcatgcgaccgtggcgatctcgggcgaagcc
gccgacgagatcttcgggggctatccgtggttccaccgcgaggaagccctgaacgccgac
acgttcccgtggtcgctcgccacaccggaccgcgtgaacctgctctcgaaggacttcgtc
gattgggtgaagcccgagcagtatgtcaaggagcgctaccggcaggccctctccgaggtg
ccccgtctggccggcgagaaccagcagcagaaccggatgcgggagatgtcgtaccttaat
atcacccgcttcatgccgacgctgctcgaccgcaaggaccgcatgagcatggccgtcggg
ctcgaggtgcgcgtgccgttctgcgaccacaggctggtggagtacgtgtggaacatcccc
tgggagatcaagacgagcggcgaccgggagaagggtattctccgcaaggcgctgcggggt
gtccttcccgaggatgtgctgacacgcaaaaaaagcccctatccgaaaacgcacaacccg
aactatctggctgcggtccgctcgtgggtgctggagattctggacgattcgtcctccccg
ctgctgcagttcatcgatgtagccaaaatccgggccctcgccgaggacgacggcggcaag
ttcgatcttccgtggttcggccagctgatgaccggcccccagctcttcgcctatctggcg
caggtcgatacctggctgcggcagtacaaggtggcgatccggtaa

DBGET integrated database retrieval system