KEGG   Paenibacillus mucilaginosus K02: B2K_31230Help
Entry
B2K_31230         CDS       T02041                                 

Definition
spore coat protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    B2K_31230
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B2K_31230
Enzymes [BR:pmw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     B2K_31230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7389163..7389618)
Genome map
AA seq 151 aa AA seqDB search
MIRNVLTKTLIRHSDDRGFFMELLREDDEIFNGFGQASLSLSYPGVIKAFHYHAQQDDIW
YFPSGQAQVVLHDLRPDSPTYKQTDVYYMGELSPYLLFIPRGVAHGYRVLGHLPATIVYF
TNKAYDPADPDEFRLAYNDPDIGFNWQTRFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaaacgtgctgaccaagacgctgatccggcatagcgacgaccggggatttttc
atggagctgctgcgggaggacgacgaaatcttcaacggcttcgggcaggcttccttgtcc
ctgagctatccgggagtaatcaaagcgttccactaccacgcgcagcaggatgatatctgg
tacttcccgtcggggcaggctcaggtggtgctgcatgatctgcggccggattcgccgacc
tacaagcagacggacgtgtattacatgggagaactcagtccgtatctgctcttcatcccg
cggggcgtggcccacggctaccgggtgctggggcatctgccggcgacgatcgtctacttc
acgaacaaggcctatgatccggccgacccggatgaattccggctggcttacaacgacccg
gatatcggtttcaactggcagacccgattccgctga

DBGET integrated database retrieval system