KEGG   Paenibacillus mucilaginosus K02: B2K_31730Help
Entry
B2K_31730         CDS       T02041                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B2K_31730
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    B2K_31730
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     B2K_31730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7504605..7506185)
Genome map
AA seq 526 aa AA seqDB search
MERSKLSLKQKIGQLLMCGFPGTEPTPEMEELIRDGGIGGIIYFRRNLAEPAQAAALSAK
LQGFAAEGSGVPLLIAVDQEGGMVTRIEQGVSVMPGAMALGATGDADAAYEAAKVTAAEL
LAMGINMNFAPVLDVNNNPLNPVIGVRSYGGDPELVARLGTAAVRGYQETGVAATVKHFP
GHGDTSQDSHHELPTVPHDRGRLDRLELVPFREAVRQGVDAVMTAHLLFPAVEPEPLPAT
LSPRVLTGLLREELGYGGVIVTDCLEMNAIAGHYGVAEGAVLAVEAGADLVLVSHRIELQ
RAALDALTAAVESGRLSEERIDRSVDRLLALKARRAVQAAEGTAPLIGRTLATPASQAFA
ERIGEASVTLVAGELQPLERGRRVLVVWPEVRVGSEVDEVLGRKESLGHWLAQMGFVVRE
ERIGVRPTEEERQRVLRLAREGGQAVAVSYNAAFEPEQAALIRELAELPGLRLTAASVRI
PSDLAVLGRVRVYLACYENTPFAMKALARVLGGELAPAGVLPAPIL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagtaaactgagtctcaagcaaaagatcgggcagctgctcatgtgcggattc
ccggggacggaaccgacgccggagatggaggagctgatccgggacggcgggatcggcggc
attatctatttccggcgcaacctggcggagccggcccaagcggccgccttgtcggcgaag
ctgcagggcttcgcggccgaaggcagcggggtgccgctgctcattgctgtcgaccaggag
ggcgggatggtcacccgcatcgaacagggcgtaagcgtcatgccgggggcgatggcgctc
ggggcgaccggcgacgcggacgccgcgtacgaagcggccaaagtaacggctgccgagctg
ctggcgatgggcatcaacatgaacttcgccccggtgctcgacgtgaacaacaacccgctc
aacccggtgatcggcgtccgctcctacggcggggaccccgagctcgtggcgcggctgggt
accgcggccgtgcggggataccaggagacgggcgtcgccgctacggtcaagcacttcccc
ggccacggcgacacctcgcaggattcacatcacgagctgcctacggtgccgcatgaccgc
gggcggctcgaccggctggagctggtgccgttccgcgaagccgtccggcagggcgtggac
gccgtgatgacggcccacctgctcttcccggcggtggagccggaaccgctgccggctacg
ctgtcgccgcgcgtgctgaccgggctcctgcgcgaggagctcggctacgggggcgtcatc
gtcaccgactgcctcgagatgaacgccatcgccgggcattacggcgtggcggagggggct
gtgctcgccgtggaggccggcgcggaccttgtgctcgtctcgcaccgcatcgagctgcag
cgggcggcgctggacgcgctgaccgccgccgtggagagcggccgcctcagcgaagagcgc
atcgaccgctcggtcgaccggctgctcgcgctgaaggcgcggcgggcagtgcaggcggcc
gaagggacggcgccgctgatcggccgcacgctggccaccccggcgtcgcaggccttcgcc
gagcggatcggcgaagccagcgtgacgctcgtggccggcgagctgcagccgctggagcgc
ggccggcgcgtgctcgtcgtctggccggaggtgcgggtcggctccgaggtcgacgaagtg
ctcggccgcaaggagtcgctcggccactggctcgcccagatgggcttcgtcgtgcgcgag
gagcggatcggcgtccggccgaccgaagaggagcggcagcgcgtgctgaggctggcccgc
gagggcgggcaggccgtagccgtgagctacaacgcggcgttcgagccggagcaggcggcg
ctgatccgcgagctggcggagctgccgggcctgcggcttaccgcggcgtccgtgcgcatc
ccctcggacctggcggtcctgggccgtgtgcgggtgtatctcgcctgctatgagaacacc
ccgttcgcgatgaaggcgctcgcgcgggtactgggaggtgaacttgcgccggccggcgtg
ctgccggctccgattttgtag

DBGET integrated database retrieval system