KEGG   Paenibacillus mucilaginosus K02: B2K_32120Help
Entry
B2K_32120         CDS       T02041                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Organism
pmw  Paenibacillus mucilaginosus K02
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7593133..7594023)
Genome map
AA seq 296 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPVIDKPTIQYIVEEAVASGIEDLIIVTGKG
KRAIEDHFDHAFELEKNLEDKGKIDLLREVQRSARVEIHYIRQKEPKGLGHAIWCARRFI
GDEPFAVLLGDDIVQGDTPCLKQLIQEYEKSQSSVIGVQPVSLEETQRYGIIDTGTKNGR
LYEVQNLVEKPPLGKAPSNLAIMGRYVLTPRIFDFLALQETGAGGEIQLTDAIQKLSEIE
KVYAYNYSGVRYDVGEKLGYILTNLDFALKNKELNQPLLKALEELVALEEAAETIG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtaagaaaagcaatcattcccgcagcgggtctcggcacgcgttttctgcct
gcaaccaaagccatgcctaaagaaatgcttcctgtcattgataagcctacgatccagtac
atcgtggaagaagccgtcgcttcggggatcgaggatctcatcatcgtaacgggcaaaggg
aagagagcgatcgaagaccacttcgaccatgccttcgagctggagaagaacctggaggac
aagggcaagatcgacctgctccgcgaagttcagcgttccgccagagtcgaaattcactac
atccgtcaaaaagaaccgaaaggtctcggacacgcgatttggtgcgcaagaaggttcatc
ggtgacgagccgttcgccgttctgctcggggacgacatcgtacaaggggatacgccgtgc
ctgaagcagctgatccaggaatatgagaagtcacagagctccgtgatcggggtgcagccg
gtatccctggaagaaacgcagcgttacggcattatcgatacgggcaccaaaaacggccgg
ctctatgaagtacagaacctggtggagaagccgccgctcggcaaagcgccgtccaatctg
gccatcatgggccgttacgtgctgacaccgcgcatcttcgatttcctggcactgcaggag
acgggagcgggcggagaaatccagctgaccgatgcgatccagaagctgagcgaaatcgag
aaggtttatgcttataactacagcggcgtaagatacgacgtcggtgagaaattgggatac
attcttacgaacctggactttgccctgaagaacaaggagctgaaccaaccgctcttgaag
gcactggaagagctggtcgcactagaagaagcagccgaaacaatcgggtag

DBGET integrated database retrieval system