KEGG   Paenibacillus mucilaginosus K02: B2K_32755Help
Entry
B2K_32755         CDS       T02041                                 

Definition
L-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B2K_32755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B2K_32755
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B2K_32755
Enzymes [BR:pmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B2K_32755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7736698..7737942)
Genome map
AA seq 414 aa AA seqDB search
MKLRCTACGREWSIDRQLLHCPCGGLLEVEQDERDWDGERLRRLFDERLAERRSLYASGV
WRYKELIHPLLPEDCAVTKYEGNTGLYASEPVRAFAGVAGLLLKAQSENPSGSFKDNGMV
AAVSHGLSLGYRRFACTSTGNTSASLAMYAALAGCQSYVFVPESGVAESKVLQTAAYGAR
LIRFEGTYDDGIRFLEAHAEELELYVCNSVNPLRIEGQKSMVYELAHSLQWSLPDWIVLP
GGALSNASALGKGLRDLLRLGLISRLPRVLVVQAEGASPFHRLMAGGGDRLEPEPRPWTL
ASALNIGNPPSWEKARGVLRDTDGLTVAVSDGEILEAKACIDRAGIGCEPASAAAVAGLR
KLVREGRIDKEASAVCLLTGHLLKDLDALKRIPAGPSCAAGSLEPGSVRRLIEG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcggtgtacggcctgcgggcgggaatggagtatcgacaggcagctgctgcac
tgtccctgcgggggactgctggaagtggagcaggatgagcgggactgggacggggagcga
ctgaggcggctctttgacgagcggctggcggaacgccggagcctttatgccagcggtgta
tggcggtacaaggagctgatccacccccttctgccggaagactgcgcggtgaccaagtat
gaaggcaatacagggctgtatgcctccgaaccggtacgcgcctttgccggcgtggccggt
ctgctgctcaaggcgcagagcgagaacccgagcggttccttcaaggacaacggcatggtg
gcggccgtatcccacggcctgtcgctcgggtatcgccgcttcgcctgcacctcgacaggc
aacacctcggcgtcgctggcgatgtacgccgcactggcgggctgccagtcttacgtcttc
gtgccggagtcgggggtggccgagagcaaggtgctccagacggcggcgtacggtgcccgg
ctgatccgcttcgaagggacctatgacgatggcatccgcttcctcgaggcccatgcggag
gagcttgagctgtatgtctgcaattcggtcaacccgctgcggatcgagggccagaagagc
atggtctacgagctggcgcacagcctgcagtggagcctgccggattggatcgtgctgccg
ggcggcgcgctgagcaatgcctcggcgctcggcaaagggctgcgcgatctgctgcggctc
gggctgatctcccgcctgccgcgggtgctcgtggtccaggcggagggggccagccccttc
caccggctgatggccggcggtggggaccgcctggagccggagccccgcccatggacgctg
gcgagcgcgctcaacatcgggaatccgccgagctgggagaaagccaggggcgtcctgcgg
gataccgacggtcttaccgtggcggtctccgatggggagatcctggaggcgaaggcctgc
atagaccgcgccggcatcggctgcgaaccggcttcagccgccgccgtggcaggactccgc
aagctggtccgcgagggaaggatcgacaaggaggcgtcggccgtctgtctgctgaccggg
catctgctcaaagacctcgatgcgctgaagaggatcccggcagggccgagctgcgcagcg
ggcagcctggagccggggtctgtccggaggctgatcgaaggataa

DBGET integrated database retrieval system