KEGG   Paenibacillus mucilaginosus K02: B2K_35345Help
Entry
B2K_35345         CDS       T02041                                 

Definition
guanidinobutyrase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B2K_35345
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     B2K_35345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8317710..8318672)
Genome map
AA seq 320 aa AA seqDB search
MQYPLSPDVQPEFCTTGSFMRLPAKREGARLAIVGMPFDTAASFRVGARFAPQAIRQGSM
LLFPYHPVHKVYPFEETKAIDIGDVSVIPHNIHRSYELMEASALELMQAGIVPVGLGGDH
SVTLAALRAAAKVHGPVALVHFDSHTDTWDTYYDEKYWHGSTFIRAHEEGLVVPSKVFQI
GIRGTLNHPGDLEASYDLGFNVITSGELRAAGIPEVVRRVKETVGDMPVFLTFDIDFVDP
AYAPGTGTPEVGGFTSHETLELVRSLTGLNYIGFDLVEVLPGYDPAQTTSLLAATLIHEF
ASLVALNLKTASPQESITGA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatccgttatctcccgatgttcagcccgagttctgtacgaccggctcgttcatg
cggcttccggcgaagcgggaaggcgcaaggcttgcgatcgtcggcatgccgttcgatacg
gccgcctcgttccgggtgggggcgcgcttcgcgccgcaggcgatccgccagggatcgatg
ctcctgttcccctaccacccggtgcataaggtatacccgttcgaggagacgaaggccatc
gacatcggggatgtctcggtcatcccgcacaacatccaccgcagctatgagctgatggaa
gccagcgcgctggagctgatgcaggccgggatcgtaccggtcggccttgggggggaccac
tccgtgacgctggctgcgctgcgtgcggcggccaaggtgcacgggccggtggcgctggtg
cattttgactcccacacggatacgtgggacacctactacgatgagaagtactggcacggc
tccaccttcatccgtgcgcatgaggaaggactcgtcgtcccttccaaggtgttccagatc
gggatccggggaacgctgaaccatcccggcgatctggaggcgagctacgatctcgggttc
aacgtgatcacctcgggagaactccgagcggcgggcattccggaggtcgtgcgccgcgtc
aaggaaacggtcggcgatatgccggtgttcctgaccttcgacatcgacttcgtcgatccg
gcctatgcgccggggacggggacgccggaggtcggcggattcacaagccatgagacgctc
gagctcgtccggtcgctgaccggtttgaactatatcgggttcgacctggtcgaagtgctg
ccgggctatgatccggcccagacgacttcgctgctggctgcgacgctgatccacgagttc
gcgagtctggtcgccctgaaccttaagacggcgagcccgcaggagagcatcacgggggcc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system