KEGG   Paenibacillus mucilaginosus K02: B2K_35780Help
Entry
B2K_35780         CDS       T02041                                 

Definition
glutamyl-tRNA synthase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    B2K_35780
Enzymes [BR:pmw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     B2K_35780
Amino acid related enzymes [BR:pmw01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   B2K_35780
Transfer RNA biogenesis [BR:pmw03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    B2K_35780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8400665..8402116)
Genome map
AA seq 483 aa AA seqDB search
MSELRVRYAPSPTGHLHIGGARTALFDYLLARKEGGKFIIRFEDTDQTRHLESGIGSQLE
GLKWLGVDWDESVDIGGPYGPYRQTERLDLYQPFVEQLLREGNAYRCYCSEADLEQERAA
QEAAGEMPMYSGRCRHLTAEQIAAFEAEGRKPSIRFRVPADQTISFVDRIREQVEFETNG
IGDFIIVRPDGIPTYNFAVILDDHLMKISLVIRGEEHLTNTPRQIMMYEALGLPVPEFAH
LALILNQDRKKMSKRDESIIQFIEQYRELGYLPEAVMNFIALLGWSPKGEEEIFTKEELI
AQFDLDRVSKSPAVFDMDKLNWMNNQYIKKADTDRITALALPHLQQAGRLPEELTAEQQQ
WVRSLVGLYQEQLRYAAEIVPLSELFFREDASYDEEAQAMLGEEHAPVVLRSFLEQVEGA
AEFSVDALKGLIKAVQTSTGYKGKQLFMTIRVALTGQMHGPDLNMTLYLLGRETVAARLK
KLL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagttacgggtaaggtatgctccgagtcctacgggacacttacatatcggcggg
gcgagaacggccctgttcgattatttgcttgctcgcaaggaaggcggcaagttcattatc
cgcttcgaagatacggatcagacacggcatctggagtccgggatcggcagccagctcgaa
gggctgaagtggcttggcgtcgattgggacgagagcgtggatatcggcgggccttatggt
ccttaccggcagaccgagcggctggacctgtatcagccttttgtggagcagctgctgaga
gagggcaacgcttaccgctgttactgctccgaagcggatctagagcaggagcgggccgct
caggaggccgccggcgagatgccgatgtactccggccgctgccgccacctgacggccgag
cagatcgccgccttcgaggcggagggacgcaagccgtcgatccgtttccgcgtgccggcg
gaccagaccatctcgttcgtggaccgtatacgcgagcaggtggagttcgagacgaacggc
atcggagatttcattatcgtccgtccggatgggattcctacctataactttgcggttatt
ctggatgaccacctgatgaagatcagtctggtgatccgcggggaggagcacctgacgaac
accccccgccagatcatgatgtacgaggcgctggggctgcctgtaccggagtttgcccac
ctcgcgctgatcctgaaccaggaccgcaagaagatgagcaagcgcgatgaatccatcatt
caattcatcgagcagtatagagagctcggttacctgccggaagcggttatgaacttcatc
gccctgctgggctggtcccccaaaggggaagaggagatcttcaccaaggaggaactgatc
gcccagttcgatctcgaccgggtatcgaagagtccggccgtattcgatatggataaactg
aactggatgaacaaccaatatatcaagaaagccgatacggaccggatcacggccctggct
ctgccgcacctgcagcaggccggacgcctgccggaagagcttacggccgagcagcagcag
tgggtccgttcgctggtgggactttatcaggagcagcttcgctatgcggctgagatcgtc
cctctttccgagctgttcttccgagaggacgccagctacgacgaggaagcccaggctatg
ctcggggaagaacatgcaccggtagtgcttcgcagcttcctggagcaagtggaaggggcg
gctgagttcagcgtggatgcgctcaaaggcctgattaaggccgtgcagacctctacaggt
tataaaggcaagcagctcttcatgaccatccgtgtggcgctgaccggccaaatgcatggt
ccggatctcaacatgaccctgtatcttcttggtcgtgagacggtagccgcgcggcttaag
aaattattgtaa

DBGET integrated database retrieval system