KEGG   Paenibacillus mucilaginosus K02: B2K_35855Help
Entry
B2K_35855         CDS       T02041                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B2K_35855
Enzymes [BR:pmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     B2K_35855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8422095..8422628)
Genome map
AA seq 177 aa AA seqDB search
MMNEEKADIHSQEDLAVAYIGLGSNLGDREQYLKEALRMLEEHPEIRILGLSSFYETDPV
GYVDQDPFLNMVAAVGTTLSPEDLFAQMLGAEQHLGRKREVRWGPRTIDLDLLLYGSRTQ
EDPRLILPHPRMMERAFVLIPLIEVMKAQNPQQTGALEDHLRRLSGKEGVTLWKRMQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgaagagaaggcggatatacattcgcaggaagatctggcggtggcttatatc
ggcctcggctccaacctgggcgaccgggagcagtacctgaaggaggcgctccgcatgctg
gaagagcatccggagatccgcatcctcggcttgtcctccttctatgagacggatccggtc
ggctatgtcgatcaggacccgttcctgaacatggtggcggcagtcggaacgacgctgtcg
ccggaggatttgtttgcgcagatgctgggtgccgagcagcacctggggcgcaagcgggag
gtgcgatgggggccaagaaccatcgatctcgatctgttgctctacggaagccgcacccaa
gaggatccccgtctgattctgccgcatccccgcatgatggaacgtgccttcgtgctcatt
ccgctcatcgaggtgatgaaggctcagaatccgcagcagacaggggccctcgaagatcat
cttcggcggctttcaggaaaggaaggcgttacgttatggaaaagaatgcagtag

DBGET integrated database retrieval system